From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002337000
  • symbol?: sdrE
  • description?: MSCRAMM family adhesin SdrE

      descriptions from strain specific annotations:

    • MSCRAMM family adhesin SdrE
    • sdrE protein
    • Ser-Asp rich fibrinogen-binding, bone sialoprotein-binding protein
    • Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrE
    • serine-aspartate repeat-containing protein E
    • cell wall anchor domain-containing protein
    • Fibronectin-binding protein
    • LPXTG-motif cell wall anchor domain-containing protein
    • Ser-Asp rich fibrinogen-binding, bone sialoprotein-binding protein Bbp
    • Ser-Asp rich fibrinogen-binding/bone sialoprotein-binding protein
    • Ser-Asp rich fibrinogen-binding bone sialoprotein-binding protein
  • strand?: +
  • coordinates?: 2867235..2876151
  • synteny block?: BlockID0016360
  • occurrence?: in 88% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0610 (sdrE)
    N315:
    SA0521 (sdrE)
    NCTC8325:
    Newman:
    NWMN_0525 (sdrE)
    USA300_FPR3757:
    04-02981:
    SA2981_0540 (sdrE)
    08BA02176:
    C248_0638 (bbp)
    11819-97:
    MS7_0553 (sdrE)
    71193:
    ST398NM01_2827
    ECT-R 2:
    ECTR2_517
    ED133:
    SAOV_0598 (sdrE)
    ED98:
    SAAV_0526 (sdrE)
    HO 5096 0412:
    SAEMRSA15_04900 (sdrE)
    JH1:
    SaurJH1_0600
    JH9:
    SaurJH9_0586
    JKD6008:
    SAA6008_00571
    JKD6159:
    SAA6159_00517 (sdrE)
    LGA251:
    SARLGA251_04990 (sdrE)
    M013:
    M013TW_0550
    MRSA252:
    SAR0567 (bbp)
    MSHR1132:
    MSSA476:
    SAS0521
    Mu3:
    SAHV_0561 (sdrE)
    Mu50:
    SAV0563 (sdrE)
    MW2:
    MW0518 (sdrE)
    RF122:
    SAB0513
    ST398:
    T0131:
    SAT0131_00623
    TCH60:
    HMPREF0772_12626
    TW20:
    SATW20_06330 (sdrE)
    USA300_TCH1516:
    USA300HOU_0557 (sdrE)
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MINRDNKKAITKKGMISNRLNKFSIRKYTVGTASILVGTTLIFGLGNQEAKAAENTSTEN
    N315            MINRDNKKAITKKGMISNRLNKFSIRKYTVGTASILVGTTLIFGLGNQEAKAAENTSTEN
    Newman          MINRDNKKAITKKGMISNRLNKFSIRKYTVGTASILVGTTLIFGLGNQEAKAAENTSTEN
    USA300_FPR3757  MINRDNKKAITKKGMISNRLNKFSIRKYTVGTASILVGTTLIFGLGNQEAKAAENTSTEN
                    ************************************************************

    COL             AKQDDATTSDNKEVVSETENNSTTENNSTNPIKKETNTDSQPEAKKESTSSSTQKQQNNV
    N315            AKQDDATTSDNKEVVSETENNSTTENDSTNPIKKETNTDSQPEAKEESTTSSTQQQQNNV
    Newman          AKQDDATTSDNKEVVSETENNSTTENNSTNPIKKETNTDSQPEAKKESTSSSTQKQQNNV
    USA300_FPR3757  AKQDDATTSDNKEVVSETENNSTTENNSTNPIKKETNTDSQPEAKKESTSSSTQKQQNNV
                    **************************:******************:***:****:*****

    COL             TATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTTKPSTSEPSTSEIQ
    N315            TATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNYTNNDVTTK-----PSTSEIQ
    Newman          TATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTTKPSTSEPSTSEIQ
    USA300_FPR3757  TATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTTKPSTSEPSTSEIQ
                    *************************************** ********     *******

    COL             TKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKKNPEKLKELVRNDS
    N315            TKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKNNPEKLKELVRNDN
    Newman          TKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKNNPEKLKELVRNDS
    USA300_FPR3757  TKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKNNPEKLKELVRNDS
                    **********************************************:************.

    COL             NTDHSTKPVATAPTSVAPKRVNAKMRFAVAQPAAVASNNVNDLIKVTKQTIKVGDGKDNV
    N315            NTDRSTKPVATAPTSVAPKRLNAKMRFAVAQPAAVASNNVNDLITVTKQTIKVGDGKDNV
    Newman          NTDHSTKPVATAPTSVAPKRVNAKMRFAVAQPAAVASNNVNDLIKVTKQTIKVGDGKDNV
    USA300_FPR3757  NTDHSTKPVATAPTSVAPKRVNAKMRFAVAQPAAVASNNVNDLIKVTKQTIKVGDGKDNV
                    ***:****************:***********************.***************

    COL             AAAHDGKDIEYDTEFTIDNKVKKGDTMTINYDKNVIPSDLTDKNDPIDITDPSGEVIAKG
    N315            AAAHDGKDIEYDTEFTIDNKVKKGDTMTINYDKNVIPSDLTDKNDPIDITDPSGEVIAKG
    Newman          AAAHDGKDIEYDTEFTIDNKVKKGDTMTINYDKNVIPSDLTDKNDPIDITDPSGEVIAKG
    USA300_FPR3757  AAAHDGKDIEYDTEFTIDNKVKKGDTMTINYDKNVIPSDLTDKNDPIDITDPSGEVIAKG
                    ************************************************************

    COL             TFDKATKQITYTFTDYVDKYEDIKSRLTLYSYIDKKTVPNETSLNLTFATAGKETSQNVT
    N315            TFDKATKQITYTFTDYVDKYEDIKARLTLYSYIDKQAVPNETSLNLTFATAGKETSQNVS
    Newman          TFDKATKQITYTFTDYVDKYEDIKSRLTLYSYIDKKTVPNETSLNLTFATAGKETSQNVT
    USA300_FPR3757  TFDKATKQITYTFTDYVDKYEDIKSRLTLYSYIDKKTVPNETSLNLTFATAGKETSQNVT
                    ************************:**********::**********************:

    COL             VDYQDPMVHGDSNIQSIFTKLDEDKQTIEQQIYVNPLKKSATNTKVDIAGSQVDDYGNIK
    N315            VDYQDPMVHGDSNIQSIFTKLDENKQTIEQQIYVNPLKKTATNTKVDIAGSQVDDYGNIK
    Newman          VDYQDPMVHGDSNIQSIFTKLDEDKQTIEQQIYVNPLKKSATNTKVDIAGSQVDDYGNIK
    USA300_FPR3757  VDYQDPMVHGDSNIQSIFTKLDEDKQTIEQQIYVNPLKKSATNTKVDIAGSQVDDYGNIK
                    ***********************:***************:********************

    COL             LGNGSTIIDQNTEIKVYKVNSDQQLPQSNRIYDFSQYEDVTSQFDNKKSFSNNVATLDFG
    N315            LGNGSTIIDQNTEIKVYKVNPNQQLPQSNRIYDFSQYEDVTSQFDNKKSFSNNVATLDFG
    Newman          LGNGSTIIDQNTEIKVYKVNSDQQLPQSNRIYDFSQYEDVTSQFDNKKSFSNNVATLDFG
    USA300_FPR3757  LGNGSTIIDQNTEIKVYKVNSDQQLPQSNRIYDFSQYEDVTSQFDNKKSFSNNVATLDFG
                    ********************.:**************************************

    COL             DINSAYIIKVVSKYTPTSDGELDIAQGTSMRTTDKYGYYNYAGYSNFIVTSNDTGGGDGT
    N315            DINSAYIIKVVSKYTPTSDGELDIAQGTSMRTTDKYGYYNYAGYSNFIVTSNDTGGGDGT
    Newman          DINSAYIIKVVSKYTPTSDGELDIAQGTSMRTTDKYGYYNYAGYSNFIVTSNDTGGGDGT
    USA300_FPR3757  DINSAYIIKVVSKYTPTSDGELDIAQGTSMRTTDKYGYYNYAGYSNFIVTSNDTGGGDGT
                    ************************************************************

    COL             VKPEEKLYKIGDYVWEDVDKDGVQGTDSKEKPMANVLVTLTYPDGTTKSVRTDANGHYEF
    N315            VKPEEKLYKIGDYVWEDVDKDGVQGTDSKEKPMANVLVTLTYPDGTTKSVRTDANGHYEF
    Newman          VKPEEKLYKIGDYVWEDVDKDGVQGTDSKEKPMANVLVTLTYPDGTTKSVRTDANGHYEF
    USA300_FPR3757  VKPEEKLYKIGDYVWEDVDKDGVQGTDSKEKPMANVLVTLTYPDGTTKSVRTDANGHYEF
                    ************************************************************

    COL             GGLKDGETYTVKFETPTGYLPTKVNGTTDGEKDSNGSSVTVKINGKDDMSLDTGFYKEPK
    N315            GGLKDGETYTVKFETPAGYLPTKVNGTTDGEKDSNGSSITVKINGKDDMSLDTGFYKEPK
    Newman          GGLKDGETYTVKFETPTGYLPTKVNGTTDGEKDSNGSSVTVKINGKDDMSLDTGFYKEPK
    USA300_FPR3757  GGLKDGETYTVKFETPTGYLPTKVNGTTDGEKDSNGSSVTVKINGKDDMSLDTGFYKEPK
                    ****************:*********************:*********************

    COL             YNLGDYVWEDTNKDGIQDANEPGIKDVKVTLKDSTGKVIGTTTTDASGKYKFTDLDNGNY
    N315            YNLGDYVWEDTNKDGIQDANEPGIKDVKVTLKDSTGKVIGTTTTDASGKYKFTDLDNGNY
    Newman          YNLGDYVWEDTNKDGIQDANEPGIKDVKVTLKDSTGKVIGTTTTDASGKYKFTDLDNGNY
    USA300_FPR3757  YNLGDYVWEDTNKDGIQDANEPGIKDVKVTLKDSTGKVIGTTTTDASGKYKFTDLDNGNY
                    ************************************************************

    COL             TVEFETPAGYTPTVKNTTADDKDSNGLTTTGVIKDADNMTLDRGFYKTPKYSLGDYVWYD
    N315            TVEFETPAGYTPTVKNTTAEDKDSNGLTTTGVIKDADNMTLDSGFYKTPKYSLGDYVWYD
    Newman          TVEFETPAGYTPTVKNTTADDKDSNGLTTTGVIKDADNMTLDRGFYKTPKYSLGDYVWYD
    USA300_FPR3757  TVEFETPAGYTPTVKNTTADDKDSNGLTTTGVIKDADNMTLDSGFYKTPKYSLGDYVWYD
                    *******************:********************** *****************

    COL             SNKDGKQDSTEKGIKDVTVTLQNEKGEVIGTTKTDENGKYRFDNLDSGKYKVIFEKPAGL
    N315            SNKDGKQDSTEKGIKDVKVTLLNEKGEVIGTTKTDENGKYRFDNLDSGKYKVIFEKPAGL
    Newman          SNKDGKQDSTEKGIKDVTVTLQNEKGEVIGTTKTDENGKYRFDNLDSGKYKVIFEKPAGL
    USA300_FPR3757  SNKDGKQDSTEKGIKDVTVTLQNEKGEVIGTTKTDENGKYRFDNLDSGKYKVIFEKPAGL
                    *****************.*** **************************************

    COL             TQTVTNTTEDDKDADGGEVDVTITDHDDFTLDNGYFEEDTSDSDSDSDSDSDSDSDSDSD
    N315            TQTVTNTTEDDKDADGGEVDVTITDHDDFTLDNGYFEEDT--------------------
    Newman          TQTVTNTTEDDKDADGGEVDVTITDHDDFTLDNGYFEEDTSDSDSDSDSDSDSDSDSDSD
    USA300_FPR3757  TQTVTNTTEDDKDADGGEVDVTITDHDDFTLDNGYFEEDT------------SDSDSDSD
                    ****************************************                    

    COL             SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
    N315            SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
    Newman          SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
    USA300_FPR3757  SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
                    ************************************************************

    COL             SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
    N315            SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
    Newman          SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
    USA300_FPR3757  SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
                    ************************************************************

    COL             SDSDSDSDSDSDSDSDSDSDSDSDSDAGKHTPVKPMSTTKDHHNKAKALPETGSENNGSN
    N315            SDSDSDSDSDSDSDSDSDSDSDSDSDAGKHTPVKPMSTTKDHHNKAKALPETGSENNGSN
    Newman          SDSDSDSDSDSDSDSDSDSDSDSDSDAGKHTPVKPMSTTKDHHNKAKALPETGSENNGSN
    USA300_FPR3757  SDSDSDSDSDSDSDSDSDSDSDSDSDAGKHTPVKPMSTTKDHHNKAKALPETGSENNGSN
                    ************************************************************

    COL             NATLFGGLFAALGSLLLFGRRKKQNK
    N315            NATLFGGLFAALGSLLLFGRRKKQNK
    Newman          NATLFGGLFAALGSLLLFGRRKKQNK
    USA300_FPR3757  NATLFGGLFAALGSLLLFGRRKKQNK
                    **************************