From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002338000
  • symbol?:
  • description?: glycosyl transferase family 1

      descriptions from strain specific annotations:

    • glycosyl transferase family 1
    • glycosyl transferase, group 1 family protein
    • poly (glycerol-phosphate) alpha-glucosyltransferase
    • glycosyltransferase
    • putative glycosyl transferase
    • glycoside hydrolase family protein
    • glycosyl transferase family protein
    • glycosyl transferases group 1 family protein
    • group 1 glycosyl transferase
    • putative poly(Glycerol-phosphate)alpha-glucosyltransferase
  • strand?: +
  • coordinates?: 2876798..2878270
  • synteny block?: BlockID0016370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0541
    08BA02176:
    C248_0639
    11819-97:
    MS7_0554
    71193:
    ST398NM01_0638
    ECT-R 2:
    ECTR2_518
    ED133:
    SAOV_0599
    ED98:
    SAAV_0527
    HO 5096 0412:
    SAEMRSA15_04910
    JH1:
    SaurJH1_0601
    JH9:
    SaurJH9_0587
    JKD6008:
    SAA6008_00572
    JKD6159:
    SAA6159_00518
    LGA251:
    SARLGA251_05000
    M013:
    M013TW_0551
    MRSA252:
    SAR0568
    MSHR1132:
    SAMSHR1132_05080
    MSSA476:
    SAS0522
    Mu3:
    SAHV_0562
    Mu50:
    SAV0564
    MW2:
    MW0519
    RF122:
    SAB0514
    ST398:
    SAPIG0638
    T0131:
    SAT0131_00625
    TCH60:
    HMPREF0772_12625
    TW20:
    SATW20_06340
    USA300_TCH1516:
    USA300HOU_0558
    VC40:
    SAVC_02410

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNYILGTILESKITGVEKAQINRLKLFKQHGISSKCVYVKWNPYSYTYAKQHQIENDVFT
    N315            MNYILGTILESKITGVEKAQINRLKLFKQHGISSKCVYVKWNPYSYTYAKQHQIENDVFT
    NCTC8325        MNYILGTILESKITGVEKAQINRLKLFKQHGISSKCVYVKWNPYSYTYAKQHQIENDVFT
    Newman          MNYILGTILESKITGVEKAQINRLKLFKQHGISSKCVYVKWNPYSYTYAKQHQIENDVFT
    USA300_FPR3757  MNYILGTILESKITGVEKAQINRLKLFKQHGISSKCVYVKWNPYSYTYAKQHQIENDVFT
                    ************************************************************

    COL             MYDYFQKAINYKKTKQVNWIQYWEKSCRYTLKFVENSNDVRIYDEEQFVMYAHFLDKQYH
    N315            MYDYFQKAINYKKTKQVNWIQYWEKSCRYTLKFVENSNDVRIYDEEQFVMYAHFLDKQYH
    NCTC8325        MYDYFQKAINYKKTKQVNWIQYWEKSCRYTLKFVENSNDVRIYDEEQFVMYAHFLDKQYH
    Newman          MYDYFQKAINYKKTKQVNWIQYWEKSCRYTLKFVENSNDVRIYDEEQFVMYAHFLDKQYH
    USA300_FPR3757  MYDYFQKAINYKKTKQVNWIQYWEKSCRYTLKFVENSNDVRIYDEEQFVMYAHFLDKQYH
                    ************************************************************

    COL             QLNYVNYFDHKRRKVKRELYDGRGFLSCSRILGEGQRIVLENYYTPNGEIVIQKYFDDIK
    N315            QLNYVNYFDHKRRKVKRELYDGRGFLSCSRILGEGQRIVLENYYTPNGEIVIQKYFDDIK
    NCTC8325        QLNYVNYFDHKRRKVKRELYDGRGFLSCSRILGEGQRIVLENYYTPNGEIVIQKYFDDIK
    Newman          QLNYVNYFDHKRRKVKRELYDGRGFLSCSRILGEGQRIVLENYYTPNGEIVIQKYFDDIK
    USA300_FPR3757  QLNYVNYFDHKRRKVKRELYDGRGFLSCSRILGEGQRIVLENYYTPNGEIVIQKYFDDIK
                    ************************************************************

    COL             GKNTLTKVILNEDQHQQFFDTEDELVQYFLHQLCKNNDQIILDRPHELGNVIAGLNQSIP
    N315            GKNTLTKVILNEDQQQQFFDTEDELVQYFLHQLCKNNDQIILDRPHELGNVIAGLNQSIP
    NCTC8325        GKNTLTKVILNEDQHQQFFDTEDELVQYFLHQLCKNNDQIILDRPHELGNVIAGLNQSIP
    Newman          GKNTLTKVILNEDQHQQFFDTEDELVQYFLHQLCKNNDQIILDRPHELGNVIAGLNQSIP
    USA300_FPR3757  GKNTLTKVILNEDQHQQFFDTEDELVQYFLHQLCKNNDQIILDRPHELGNVIAGLNQSIP
                    **************:*********************************************

    COL             VIVVLHSTHLSGAGNGIKSFYKTVFNNLTRYKAIVVSTEKQCQDISQYIENKIPVINIPV
    N315            VVVVLHSTHLSGTGNGIKSFYKTVFNNLTRYKAIVVSTEQQCQDISQYIENKIPVINIPV
    NCTC8325        VIVVLHSTHLSGAGNGIKSFYKTVFNNLTRYKAIVVSTEKQCQDISQYIENKIPVINIPV
    Newman          VIVVLHSTHLSGAGNGIKSFYKTVFNNLTRYKAIVVSTEKQCQDISQYIENKIPVINIPV
    USA300_FPR3757  VIVVLHSTHLSGAGNGIKSFYKTVFNNLTRYKAIVVSTEKQCQDISQYIENKIPVINIPV
                    *:**********:**************************:********************

    COL             GYVANLKYQFDINQKEKNHIISIARLVENKQIKHQIEVIKQLVTKHPNIQLNIYGHGNGL
    N315            GYVANLKYQFDINQKEKNHIISIARLVENKQIKHQIEVIKQLVTKHPNIQLNIYGHGNGL
    NCTC8325        GYVANLKYQFDINQKEKNHIISIARLVENKQIKHQIEVIKQLVTKHPNIQLNIYGHGNGL
    Newman          GYVANLKYQFDINQKEKNHIISIARLVENKQIKHQIEVIKQLVTKHPNIQLNIYGHGNGL
    USA300_FPR3757  GYVANLKYQFDINQKEKNHIISIARLVENKQIKHQIEVIKQLVTKHPNIQLNIYGHGNGL
                    ************************************************************

    COL             SEYRQLVEDYHLSEHVKFHGFKTHINEEIAKAELMLSTSKMEGFGLAILESLSVGTPVIS
    N315            SEYRQLVEDYHLSEHVKFHGFKTHINEEIAKAELMLSTSKMEGFGLAILESLSVGTPVIS
    NCTC8325        SEYRQLVEDYHLSEHVKFHGFKTHINEEIAKAELMLSTSKMEGFGLAILESLSVGTPVIS
    Newman          SEYRQLVEDYHLSEHVKFHGFKTHINEEIAKAELMLSTSKMEGFGLAILESLSVGTPVIS
    USA300_FPR3757  SEYRQLVEDYHLSEHVKFHGFKTHINEEIAKAELMLSTSKMEGFGLAILESLSVGTPVIS
                    ************************************************************

    COL             YDVDYGPSELIQDGFNGYLVPQGDINQMVEKVDQLLNNTQKLQQFSINSIESAQQYNATT
    N315            YDIDYGPSELIQDGFNGYLVPKGDINQMVEKVDQLLNNTQKLQQFSINSIESAQQYNATT
    NCTC8325        YDVDYGPSELIQDGFNGYLVPQGDINQMVEKVDQLLNNTQKLQQFSINSIESAQQYNATT
    Newman          YDVDYGPSELIQDGFNGYLVPQGDINQMVEKVDQLLNNTQKLQQFSINSIESAQQYNATT
    USA300_FPR3757  YDVDYGPSELIQDGFNGYLVPQGDINQMVEKVDQLLNNTQKLQQFSINSIESAQQYNATT
                    **:******************:**************************************

    COL             ISTKWQNILN
    N315            ISTKWQNILN
    NCTC8325        ISTKWQNILN
    Newman          ISTKWQNILN
    USA300_FPR3757  ISTKWQNILN
                    **********