From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan002344000
  • symbol?: bshB2
  • description?: glcNAc-PI de-N-acetylase family protein

      descriptions from strain specific annotations:

    • glcNAc-PI de-N-acetylase family protein
    • bacillithiol biosynthesis deacetylase BshB2
    • GlcNAc-PI de-N-acetylase
    • LmbE family protein
    • conserved protein, Carbohydrate Esterase Family 14
    • GlcNAc-PI de-N-acetylasee
  • strand?: -
  • coordinates?: 2884568..2885233
  • synteny block?: BlockID0016430
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0544
    08BA02176:
    C248_0642
    11819-97:
    MS7_0557 (bshB2)
    71193:
    ST398NM01_0642
    ECT-R 2:
    ECTR2_521
    ED133:
    SAOV_0602c
    ED98:
    SAAV_0530
    HO 5096 0412:
    SAEMRSA15_04940
    JH1:
    SaurJH1_0604
    JH9:
    SaurJH9_0590
    JKD6008:
    SAA6008_00575
    JKD6159:
    SAA6159_00521
    LGA251:
    SARLGA251_05030
    M013:
    M013TW_0555
    MRSA252:
    SAR0571
    MSHR1132:
    SAMSHR1132_05110
    MSSA476:
    SAS0525
    Mu3:
    SAHV_0565
    Mu50:
    SAV0567
    MW2:
    MW0522
    RF122:
    SAB0517c
    ST398:
    SAPIG0642
    T0131:
    SAT0131_00628 (rlp)
    TCH60:
    HMPREF0772_12621
    TW20:
    SATW20_06370
    USA300_TCH1516:
    USA300HOU_0561
    VC40:
    SAVC_02425

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTDERHVLVIFPHPDDETFSSAGTLANYIQKGIPVTYACLTLGQMGRNLGNPPFATRESL
    N315            MTDERHVLVIFPHPDDETFSSAGTLASYIQKGIPVTYACLTLGQMGRNLGNPPFATRESL
    NCTC8325        MTDERHVLVIFPHPDDETFSSAGTLANYIQKGIPVTYACLTLGQMGRNLGNPPFATRESL
    Newman          MTDERHVLVIFPHPDDETFSSAGTLANYIQKGIPVTYACLTLGQMGRNLGNPPFATRESL
    USA300_FPR3757  MTDERHVLVIFPHPDDETFSSAGTLANYIQKGIPVTYACLTLGQMGRNLGNPPFATRESL
                    **************************.*********************************

    COL             PSIRERELEEACKVIGITDLRKMGLRDKTVEFEPYEHIDGMIKSLIDDTNPSLIISFYPG
    N315            PSIRERELEEACKVIGITDLRKMGLRDKTVEFEPYEHIDGMIKSLIDDTNPSLIISFYPG
    NCTC8325        PSIRERELEEACKVIGITDLRKMGLRDKTVEFEPYEHIDGMIKSLIDDTNPSLIISFYPG
    Newman          PSIRERELEEACKVIGITDLRKMGLRDKTVEFEPYEHIDGMIKSLIDDTNPSLIISFYPG
    USA300_FPR3757  PSIRERELEEACKVIGITDLRKMGLRDKTVEFEPYEHIDGMIKSLIDDTNPSLIISFYPG
                    ************************************************************

    COL             YAVHPDHEATADAVIRTVERMPKEERPRLTLVAFSNDATEALGEPDIQNDITDFKELKIK
    N315            YAVHPDHEATADAVIRTVERMPKEERPRLTLVAFSNDATEALGEPDIQNDITDFKELKIK
    NCTC8325        YAVHPDHEATADAVIRTVERMPKEERPRLTLVAFSNDATEALGEPDIQNDITDFKELKIK
    Newman          YAVHPDHEATADAVIRTVERMPKEERPRLTLVAFSNDATEALGEPDIQNDITDFKELKIK
    USA300_FPR3757  YAVHPDHEATADAVIRTVERMPKEERPRLTLVAFSNDATEALGEPDIQNDITDFKELKIK
                    ************************************************************

    COL             AFEAHASQTGPFLKQLASPEIDGKQHSFLTVEPYWTYHFKS
    N315            AFEAHASQTGPFLKQLASPEIDGKQHSFLTVEPYWTYHFKS
    NCTC8325        AFEAHASQTGPFLKQLASPEIDGKQHSFLTVEPYWTYHFKS
    Newman          AFEAHASQTGPFLKQLASPEIDGKQHSFLTVEPYWTYHFKS
    USA300_FPR3757  AFEAHASQTGPFLKQLASPEIDGKQHSFLTVEPYWTYHFKS
                    *****************************************