From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002350000
  • symbol?: proP
  • description?: proline/betaine transporter-like protein

      descriptions from strain specific annotations:

    • proline/betaine transporter-like protein
    • major facilitator transporter
    • proline/betaine transporter homologue
    • osmoprotectant proline transporter
    • L-Proline/Glycine betaine transporter ProP
    • sugar (and other) transporter family protein
    • putative proline/betaine transporter
    • major facilitator superfamily proline/betaine:cation symporter
    • MFS family major facilitator transporter, proline/betaine:cation symporter
    • major facilitator superfamily protein
    • L-Proline/Glycine betaine transporter, ProP
    • major facilitator family transporter
  • strand?: +
  • coordinates?: 2889664..2891076
  • synteny block?: BlockID0016490
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0620 (proP)
    N315:
    SA0531 (proP)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0550 (proP)
    08BA02176:
    C248_0648 (proP)
    11819-97:
    MS7_0563
    71193:
    ST398NM01_0648
    ECT-R 2:
    ECTR2_527
    ED133:
    SAOV_0608
    ED98:
    SAAV_0536 (proP)
    HO 5096 0412:
    SAEMRSA15_05000 (proP)
    JH1:
    SaurJH1_0610
    JH9:
    SaurJH9_0596
    JKD6008:
    SAA6008_00581 (proP)
    JKD6159:
    SAA6159_00527 (proP)
    LGA251:
    SARLGA251_05090 (proP)
    M013:
    M013TW_0561
    MRSA252:
    SAR0577 (proP)
    MSHR1132:
    SAMSHR1132_05170
    MSSA476:
    SAS0531
    Mu3:
    SAHV_0571 (proP)
    Mu50:
    SAV0573 (proP)
    MW2:
    MW0528 (proP)
    RF122:
    SAB0523 (proP)
    ST398:
    SAPIG0648
    T0131:
    SAT0131_00634
    TCH60:
    HMPREF0772_12615 (proP)
    TW20:
    SATW20_06430 (proP)
    USA300_TCH1516:
    USA300HOU_0567 (proP)
    VC40:
    SAVC_02455

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDFNKENINMVDAKKAKKTVVATGIGNAMEWFDFGVYAYTTAYIGANFFSPVENADIRQM
    N315            MDFNKENINMVDAKKAKKTVVATGIGNAMEWFDFGVYAYTTAYIGANFFSPVENADIRQM
    NCTC8325        MDFNKENINMVDAKKAKKTVVATGIGNAMEWFDFGVYAYTTAYIGANFFSPVENADIRQM
    Newman          MDFNKENINMVDAKKAKKTVVATGIGNAMEWFDFGVYAYTTAYIGANFFSPVENADIRQM
    USA300_FPR3757  MDFNKENINMVDAKKAKKTVVATGIGNAMEWFDFGVYAYTTAYIGANFFSPVENADIRQM
                    ************************************************************

    COL             LTFAALAIAFLLRPIGGVVFGIIGDKYGRKVVLTSTIILMAFSTLTIGLLPSYDQIGLWA
    N315            LTFAALAIAFLLRPIGGVVFGIIGDKYGRKVVLTSTIILMAFSTLTIGLLPSYDQIGLWA
    NCTC8325        LTFAALAIAFLLRPIGGVVFGIIGDKYGRKVVLTSTIILMAFSTLTIGLLPSYDQIGLWA
    Newman          LTFAALAIAFLLRPIGGVVFGIIGDKYGRKVVLTSTIILMAFSTLTIGLLPSYDQIGLWA
    USA300_FPR3757  LTFAALAIAFLLRPIGGVVFGIIGDKYGRKVVLTSTIILMAFSTLTIGLLPSYDQIGLWA
                    ************************************************************

    COL             PILLLLARVLQGFSTGGEYAGAMTYVAESSPDKRRNSLGSGLEIGTLSGYIAASIMIAVL
    N315            PILLLLARVLQGFSTGGEYAGAMTYVAESSPDKRRNSLGSGLEIGTLSGYIAASIMIAVL
    NCTC8325        PILLLLARVLQGFSTGGEYAGAMTYVAESSPDKRRNSLGSGLEIGTLSGYIAASIMIAVL
    Newman          PILLLLARVLQGFSTGGEYAGAMTYVAESSPDKRRNSLGSGLEIGTLSGYIAASIMIAVL
    USA300_FPR3757  PILLLLARVLQGFSTGGEYAGAMTYVAESSPDKRRNSLGSGLEIGTLSGYIAASIMIAVL
                    ************************************************************

    COL             TFFLTDEQMASFGWRIPFLLGLFLGLFGLYLRRKLEESPVFENDVATQPERDNINFLQII
    N315            TFFLTDEQMASFGWRIPFLLGLFLGLFGLYLRRKLEESPVFENDVATQPERDNINFLQII
    NCTC8325        TFFLTDEQMASFGWRIPFLLGLFLGLFGLYLRRKLEESPVFENDVATQPERDNINFLQII
    Newman          TFFLTDEQMASFGWRIPFLLGLFLGLFGLYLRRKLEESPVFENDVATQPERDNINFLQII
    USA300_FPR3757  TFFLTDEQMASFGWRIPFLLGLFLGLFGLYLRRKLEESPVFENDVATQPERDNINFLQII
                    ************************************************************

    COL             RFYYKDIFVCFVAVVFFNVTNYMVTAYLPTYLEQVIKLDATTTSVLITCVMAIMIPLALM
    N315            RFYYKDIFVCFVAVVFFNVTNYMVTAYLPTYLEQVIKLDATTTSVLITCVMAIMIPLALM
    NCTC8325        RFYYKDIFVCFVAVVFFNVTNYMVTAYLPTYLEQVIKLDATTTSVLITCVMAIMIPLALM
    Newman          RFYYKDIFVCFVAVVFFNVTNYMVTAYLPTYLEQVIKLDATTTSVLITCVMAIMIPLALM
    USA300_FPR3757  RFYYKDIFVCFVAVVFFNVTNYMVTAYLPTYLEQVIKLDATTTSVLITCVMAIMIPLALM
                    ************************************************************

    COL             FGKLADKIGEKKVFLIGTGGLTLFSIIAFMLLHSQSFVVIVIGIFILGFFLSTYEATMPG
    N315            FGKLADKIGEKKVFLIGTGGLTLFSIIAFMLLHSQSFVVIVIGIFILGFFLSTYEATMPG
    NCTC8325        FGKLADKIGEKKVFLIGTGGLTLFSIIAFMLLHSQSFVVIVIGIFILGFFLSTYEATMPG
    Newman          FGKLADKIGEKKVFLIGTGGLTLFSIIAFMLLHSQSFVVIVIGIFILGFFLSTYEATMPG
    USA300_FPR3757  FGKLADKIGEKKVFLIGTGGLTLFSIIAFMLLHSQSFVVIVIGIFILGFFLSTYEATMPG
                    ************************************************************

    COL             SLPTMFYSHIRYRTLSVTFNISVSIFGGTTPLVATWLVTKTGDPLAPAYYLTAISVIGFL
    N315            SLPTMFYSHIRYRTLSVTFNISVSIFGGTTPLVATWLVTKTGDPLAPAYYLTAISVIGFL
    NCTC8325        SLPTMFYSHIRYRTLSVTFNISVSIFGGTTPLVATWLVTKTGDPLAPAYYLTAISVIGFL
    Newman          SLPTMFYSHIRYRTLSVTFNISVSIFGGTTPLVATWLVTKTGDPLAPAYYLTAISVIGFL
    USA300_FPR3757  SLPTMFYSHIRYRTLSVTFNISVSIFGGTTPLVATWLVTKTGDPLAPAYYLTAISVIGFL
                    ************************************************************

    COL             VITFLHLSTAGKSLKGSYPNVDNEQDRAYYAEHPKEALWWVKERKN
    N315            VITFLHLSTAGKSLKGSYPNVDNEQDRAYYAEHPKEALWWVKERKN
    NCTC8325        VITFLHLSTAGKSLKGSYPNVDNEQDRAYYAEHPKEALWWVKERKN
    Newman          VITFLHLSTAGKSLKGSYPNVDNEQDRAYYAEHPKEALWWVKERKN
    USA300_FPR3757  VITFLHLSTAGKSLKGSYPNVDNEQDRAYYAEHPKEALWWVKERKN
                    **********************************************