From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002363000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • Integral membrane protein
    • Threonine/Serine Exporter
  • strand?: -
  • coordinates?: 2902116..2902451
  • synteny block?: BlockID0016620
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0562
    08BA02176:
    C248_0660
    11819-97:
    MS7_0574
    71193:
    ST398NM01_0659
    ECT-R 2:
    ECTR2_538
    ED133:
    SAOV_0619c
    ED98:
    SAAV_0547
    HO 5096 0412:
    SAEMRSA15_05120
    JH1:
    SaurJH1_0622
    JH9:
    SaurJH9_0608
    JKD6008:
    SAA6008_00592
    JKD6159:
    SAA6159_00538
    LGA251:
    SARLGA251_05200
    M013:
    M013TW_0572
    MRSA252:
    SAR0590
    MSHR1132:
    SAMSHR1132_05290
    MSSA476:
    SAS0543
    Mu3:
    SAHV_0583
    Mu50:
    SAV0585
    MW2:
    MW0540
    RF122:
    SAB0535c
    ST398:
    SAPIG0659
    T0131:
    SAT0131_00646
    TCH60:
    HMPREF0772_12604
    TW20:
    SATW20_06540
    USA300_TCH1516:
    USA300HOU_0578
    VC40:
    SAVC_02510

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFWILNFIFSFLASMFFCVIFDAPRKLYLSCGFVGTCGWMVYTLFFNGFNVHTIYSSFFG
    N315            MFWILNFIFSFLASMFFCVIFDAPRKLYLSCGFVGTCGWMVYTLFFNGFNVHTIYSSFFG
    NCTC8325        MFWILNFIFSFLASMFFCVIFDAPRKLYLSCGFVGTCGWMVYTLFFNGFNVHTIYSSFFG
    Newman          MFWILNFIFSFLASMFFCVIFDAPRKLYLSCGFVGTCGWMVYTLFFNGFNVHTIYSSFFG
    USA300_FPR3757  MFWILNFIFSFLASMFFCVIFDAPRKLYLSCGFVGTCGWMVYTLFFNGFNVHTIYSSFFG
                    ************************************************************

    COL             SLALGLLSHYMARKQKEPAIIFMVTGIIPLVPGGLAYDATKNLVLLNFSTAINTMLEVTL
    N315            SLALGLLSHYMARKQKEPAIIFMVTGIIPLVPGGLAYDATKNLVLLNFSTAINTMLEVTL
    NCTC8325        SLALGLLSHYMARKQKEPAIIFMVTGIIPLVPGGLAYDATKNLVLLNFSTAINTMLEVTL
    Newman          SLALGLLSHYMARKQKEPAIIFMVTGIIPLVPGGLAYDATKNLVLLNFSTAINTMLEVTL
    USA300_FPR3757  SLALGLLSHYMARKQKEPAIIFMVTGIIPLVPGGLAYDATKNLVLLNFSTAINTMLEVTL
                    ************************************************************

    COL             IAGAIALGLLFADQISKLIVSGFVKSFKRL
    N315            IAGAIALGLLFADQISKLIVSGFVKSFKRL
    NCTC8325        IAGAIALGLLFADQISKLIVSGFVKSFKRL
    Newman          IAGAIALGLLFADQISKLIVSGFVKSFKRL
    USA300_FPR3757  IAGAIALGLLFADQISKLIVSGFVKSFKRL
                    ******************************