From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002371000
  • symbol?: mvaK1
  • description?: mevalonate kinase
  • strand?: +
  • coordinates?: 2909310..2910230
  • synteny block?: BlockID0016700
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0636 (mvk)
    N315:
    SA0547 (mvaK1)
    NCTC8325:
    Newman:
    NWMN_0553 (mvaK1)
    USA300_FPR3757:
    04-02981:
    SA2981_0567 (mvaK1)
    08BA02176:
    C248_0665 (mvaK1)
    11819-97:
    MS7_0579 (mvk)
    71193:
    ST398NM01_0664
    ECT-R 2:
    ECTR2_543 (mvk)
    ED133:
    SAOV_0624 (mvk)
    ED98:
    SAAV_0552 (mvk)
    HO 5096 0412:
    SAEMRSA15_05180 (mvaK1)
    JH1:
    SaurJH1_0628
    JH9:
    SaurJH9_0613
    JKD6008:
    SAA6008_00597 (mvaK1)
    JKD6159:
    SAA6159_00543 (mvaK1)
    LGA251:
    SARLGA251_05250 (mvaK1)
    M013:
    M013TW_0578
    MRSA252:
    SAR0596 (mvaK1)
    MSHR1132:
    SAMSHR1132_05340
    MSSA476:
    SAS0549
    Mu3:
    SAHV_0588 (mvaK1)
    Mu50:
    SAV0590 (mvaK1)
    MW2:
    MW0545 (mvaK1)
    RF122:
    SAB0540 (mvaK1)
    ST398:
    SAPIG0664 (mvk)
    T0131:
    SAT0131_00653 (hemL)
    TCH60:
    HMPREF0772_12598 (mvaK2)
    TW20:
    SATW20_06590 (mvaK1)
    USA300_TCH1516:
    USA300HOU_0583 (mvaK1)
    VC40:
    SAVC_02535

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTRKGYGESTGKIILIGEHAVTFGEPAIAVPFNAGKIKVLIEALESGNYSSIKSDVYDGM
    N315            ---------------------------MAVPFNAGKIKVLIEALESGNYSSIKSDVYDGM
    NCTC8325        MTRKGYGESTGKIILIGEHAVTFGEPAIAVPFNAGKIKVLIEALESGNYSSIKSDVYDGM
    Newman          MTRKGYGESTGKIILIGEHAVTFGEPAIAVPFNAGKIKVLIEALESGNYSSIKSDVYDGM
    USA300_FPR3757  MTRKGYGESTGKIILIGEHAVTFGEPAIAVPFNAGKIKVLIEALESGNYSSIKSDVYDGM
                                               :********************************

    COL             LYDAPDHLKSLVNRFVELNNITEPLAVTIQTNLPPSRGLGSSAAVAVAFVRASYDFLGKS
    N315            LYDAPDHLKSLVNRFVELNNITEPLAVTIQTNLPPSRGLGSSAAVAVAFVRASYDFLGKS
    NCTC8325        LYDAPDHLKSLVNRFVELNNITEPLAVTIQTNLPPSRGLGSSAAVAVAFVRASYDFLGKS
    Newman          LYDAPDHLKSLVNRFVELNNITEPLAVTIQTNLPPSRGLGSSAAVAVAFVRASYDFLGKS
    USA300_FPR3757  LYDAPDHLKSLVNRFVELNNITEPLAVTIQTNLPPSRGLGSSAAVAVAFVRASYDFLGKS
                    ************************************************************

    COL             LTKEELIEKANWAEQIAHGKPSGIDTQTIVSGKPVWFQKGHAETLKTLSLDGYMVVIDTG
    N315            LTKEELIEKANWAEQIAHGKPSGIDTQTIVSGKPVWFQKGHAETLKTLSLDGYMVVIDTG
    NCTC8325        LTKEELIEKANWAEQIAHGKPSGIDTQTIVSGKPVWFQKGHAETLKTLSLDGYMVVIDTG
    Newman          LTKEELIEKANWAEQIAHGKPSGIDTQTIVSGKPVWFQKGHAETLKTLSLDGYMVVIDTG
    USA300_FPR3757  LTKEELIEKANWAEQIAHGKPSGIDTQTIVSGKPVWFQKGHAETLKTLSLDGYMVVIDTG
                    ************************************************************

    COL             VKGSTRQAVEDVHKLCEDPQYMSHVKHIGKLVLRASDVIEHHNFEALADIFNECHADLKA
    N315            VKGSTRQAVEDVHKLCEDPQYMSHVKHIGKLVLRASDVIEHHNFEALADIFNECHADLKA
    NCTC8325        VKGSTRQAVEDVHKLCEDPQYMSHVKHIGKLVLRASDVIEHHNFEALADIFNECHADLKA
    Newman          VKGSTRQAVEDVHKLCEDPQYMSHVKHIGKLVLRASDVIEHHNFEALADIFNECHADLKA
    USA300_FPR3757  VKGSTRQAVEDVHKLCEDPQYMSHVKHIGKLVLRASDVIEHHNFEALADIFNECHADLKA
                    ************************************************************

    COL             LTVSHDKIEQLMKIGKENGAIAGKLTGAGRGGSMLLLAKDLPTAKNIVKAVEKAGAAHTW
    N315            LTVSHDKIEQLMKIGKENGAIAGKLTGAGRGGSMLLLAKDLPTAKNIVKAVEKAGAAHTW
    NCTC8325        LTVSHDKIEQLMKIGKENGAIAGKLTGAGRGGSMLLLAKDLPTAKNIVKAVEKAGAAHTW
    Newman          LTVSHDKIEQLMKIGKENGAIAGKLTGAGRGGSMLLLAKDLPTAKNIVKAVEKAGAAHTW
    USA300_FPR3757  LTVSHDKIEQLMKIGKENGAIAGKLTGAGRGGSMLLLAKDLPTAKNIVKAVEKAGAAHTW
                    ************************************************************

    COL             IENLGG
    N315            IENLGG
    NCTC8325        IENLGG
    Newman          IENLGG
    USA300_FPR3757  IENLGG
                    ******