From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002373000
  • symbol?: mvaK2
  • description?: phosphomevalonate kinase
  • strand?: +
  • coordinates?: 2911231..2912307
  • synteny block?: BlockID0016720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0549 (mvaK2)
    NCTC8325:
    Newman:
    NWMN_0555 (mvaK2)
    USA300_FPR3757:
    04-02981:
    SA2981_0569 (mvaK2)
    08BA02176:
    C248_0667 (mvaK2)
    11819-97:
    MS7_0581
    71193:
    ST398NM01_0666
    ECT-R 2:
    ECTR2_545
    ED133:
    SAOV_0626
    ED98:
    SAAV_0554
    HO 5096 0412:
    SAEMRSA15_05200 (mvaK2)
    JH1:
    SaurJH1_0630
    JH9:
    SaurJH9_0615
    JKD6008:
    SAA6008_00599 (mvaK2)
    JKD6159:
    SAA6159_00545 (mvaK2)
    LGA251:
    SARLGA251_05270 (mvaK2)
    M013:
    M013TW_0580
    MRSA252:
    SAR0598 (mvaK2)
    MSHR1132:
    SAMSHR1132_05360
    MSSA476:
    SAS0551
    Mu3:
    SAHV_0590 (mvaK2)
    Mu50:
    SAV0592 (mvaK2)
    MW2:
    MW0547 (mvaK2)
    RF122:
    SAB0542 (mvaK2)
    ST398:
    SAPIG0666
    T0131:
    SAT0131_00655
    TCH60:
    HMPREF0772_12596 (mvaK)
    TW20:
    SATW20_06610 (mvaK2)
    USA300_TCH1516:
    USA300HOU_0585 (mvaK2)
    VC40:
    SAVC_02545

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIQVKAPGKLYIAGEYAVTEPGYKSVLIALDRFVTATIEEADQYKGTIHSKALHHNPVTF
    N315            MIQVKAPGKLYIAGEYAVTEPGYKSVLIALDRFVTATIEEADQYKGTIHSKALHHNPVTF
    NCTC8325        MIQVKAPGKLYIAGEYAVTEPGYKSVLIALDRFVTATIEEADQYKGTIHSKALHHNPVTF
    Newman          MIQVKAPGKLYIAGEYAVTEPGYKSVLIALDRFVTATIEEADQYKGTIHSKALHHNPVTF
    USA300_FPR3757  MIQVKAPGKLYIAGEYAVTEPGYKSVLIALDRFVTATIEETDQYKGTIHSKALHHNPVTF
                    ****************************************:*******************

    COL             SRDEDSIVISDPHAAKQLNYVVTAIEIFEQYAKSCDIAMKHFHLTIDSNLDDSNGHKYGL
    N315            SRDEDSIVISDPHAAKQLNYVVTAIEIFEQYAKSCDIAMKHFHLTIDSNLDDSNGHKYGL
    NCTC8325        SRDEDSIVISDPHAAKQLNYVVTAIEIFEQYAKSCDIAMKHFHLTIDSNLDDSNGHKYGL
    Newman          SRDEDSIVISDPHAAKQLNYVVTAIEIFEQYAKSCDIAMKHFHLTIDSNLDDSNGHKYGL
    USA300_FPR3757  SRDEDSIVISDPHAAKQLNYVVTAIEIFEQYAKSCDIAMKHFHLTIDSNLDDSNGHKYGL
                    ************************************************************

    COL             GSSAAVLVSVIKVLNEFYDMKLSNLYIYKLAVIANMKLQSLSSCGDIAVSVYSGWLAYST
    N315            GSSAAVLVSVIKVLNEFYDMKLSNLYIYKLAVIANMKLQSLSSCGDIAVSVYSGWLAYST
    NCTC8325        GSSAAVLVSVIKVLNEFYDMKLSNLYIYKLAVIANMKLQSLSSCGDIAVSVYSGWLAYST
    Newman          GSSAAVLVSVIKVLNEFYDMKLSNLYIYKLAVIANMKLQSLSSCGDIAVSVYSGWLAYST
    USA300_FPR3757  GSSAAVLVSVIKVLNEFYDMKLSNLYIYKLAVIANMKLQSLSSCGDIAVSVYSGWLAYST
                    ************************************************************

    COL             FDHEWVKHQIEDTTVEEVLIKNWPGLHIEPLQAPENMEVLIGWTGSPASSPHFVSEVKRL
    N315            FDHEWVKHQIEDTTVEEVLIKNWPGLHIEPLQAPENMEVLIGWTGSPASSPHFVSEVKRL
    NCTC8325        FDHEWVKHQIEDTTVEEVLIKNWPGLHIEPLQAPENMEVLIGWTGSPASSPHFVSEVKRL
    Newman          FDHEWVKHQIEDTTVEEVLIKNWPGLHIEPLQAPENMEVLIGWTGSPASSPHFVSEVKRL
    USA300_FPR3757  FDHEWVKHQIEDTTVEEVLIKNWPGLHIEPLQAPENMEVLIGWTGSPASSPHFVSEVKRL
                    ************************************************************

    COL             KSDPSFYGDFLEDSHRCVEKLIHAFKTNNIKGVQKMVRQNRTIIQRMDKEATVDIETEKL
    N315            KSDPSFYGDFLEDSHRCVEKLIHAFKTNNIKGVQKMVRQNRTIIQRMDKEATVDIETEKL
    NCTC8325        KSDPSFYGDFLEDSHRCVEKLIHAFKTNNIKGVQKMVRQNRTIIQRMDKEATVDIETEKL
    Newman          KSDPSFYGDFLEDSHRCVEKLIHAFKTNNIKGVQKMVRQNRTIIQRMDKEATVDIETEKL
    USA300_FPR3757  KSDPSFYGDFLEDSHRCVEKLIHAFKTNNIKGVQKMVRQNRTIIQRMDKEATVDIETEKL
                    ************************************************************

    COL             KYLCDIAEKYHGASKTSGAGGGDCGITIINKDVDKEKIYDEWTKHGIKPLKFNIYHGQ
    N315            KYLCDIAEKYHGASKTSGAGGGDCGITIINKDVDKEKIYDEWTKHGIKPLKFNIYHGQ
    NCTC8325        KYLCDIAEKYHGASKTSGAGGGDCGITIINKDVDKEKIYDEWTKHGIKPLKFNIYHGQ
    Newman          KYLCDIAEKYHGASKTSGAGGGDCGITIINKDVDKEKIYDEWTKHGIKPLKFNIYHGQ
    USA300_FPR3757  KYLCDIAEKYHGASKTSGAGGGDCGITIINKDVDKEKIYDEWTKHGIKPLKFNIYHGQ
                    **********************************************************