From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002375000
  • symbol?:
  • description?: dihydrolipoamide dehydrogenase

      descriptions from strain specific annotations:

    • dihydrolipoamide dehydrogenase
    • pyridine nucleotide-disulfide oxidoreductase
    • putative pyridine nucleotide-disulfide oxidoreductase
    • Probable pyridine nucleotide-disulfide oxidoreductase YkgC
    • Pyridine nucleotide-disulfide oxidoreductase family protein
    • FAD-dependent pyridine nucleotide-disulfide oxidoreductase
    • Mercuric reductase
    • mercuric reductase homologue
    • mercuric reductase-like protein
    • mercury(II) reductase
    • pseudogene
    • putative dehydrogenase, Mercuric ion reductase-like protein
    • Putative Dihydrolipoamide dehydrogenase
    • putative pyridine nucleotide-disulfide oxidoreductase ykgC
    • pyridine nucleotide-disulfide oxidoreductase protein
    • pyridine nucleotide-disulfide reductase
    • Pyridine oxidoreductase
  • strand?: -
  • coordinates?: 2912880..2914094
  • synteny block?: BlockID0016740
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0571
    08BA02176:
    C248_0669
    11819-97:
    MS7_0583
    71193:
    ST398NM01_0668
    ECT-R 2:
    ECTR2_547
    ED133:
    SAOV_0628c
    ED98:
    SAAV_0556
    HO 5096 0412:
    SAEMRSA15_05220
    JH1:
    SaurJH1_0632
    JH9:
    SaurJH9_0617
    JKD6008:
    SAA6008_00601
    JKD6159:
    SAA6159_00547
    LGA251:
    SARLGA251_05290
    M013:
    M013TW_0582
    MRSA252:
    SAR0600
    MSHR1132:
    SAMSHR1132_05380
    MSSA476:
    SAS0553
    Mu3:
    SAHV_0592
    Mu50:
    SAV0594
    MW2:
    MW0549
    RF122:
    SAB0544c
    ST398:
    SAPIG0668
    T0131:
    SAT0131_00657
    TCH60:
    HMPREF0772_12594 (merA)
    TW20:
    SATW20_06630
    USA300_TCH1516:
    USA300HOU_0587
    VC40:
    SAVC_02555

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------------------------------------------MKTYDLIVIGFGKAGKTL
    N315            MLVILQLPCHIISKTNRISLLIFIMKKQSKMSLKTFKRRIYVMKTYDLIVIGFGKAGKTL
    NCTC8325        ------------------------------------------MKTYDLIVIGFGKAGKTL
    Newman          ------------------------------------------MKTYDLIVIGFGKAGKTL
    USA300_FPR3757  ------------------------------------------MKTYDLIVIGFGKAGKTL
                                                              ******************

    COL             AKYAASTGQHVAVIEQSPKMYGGTCINIGCIPSKTLVHDGLEGKSFEASYNRKNDVVNAL
    N315            AKYAASTGQHVAVIEQSSKMYGGTCINIGCIPSKTLVHDGLEGKSFEASYNRKNDVVNAL
    NCTC8325        AKYAASTGQHVAVIEQSPKMYGGTCINIGCIPSKTLVHDGLEGKSFEASYNRKNDVVNAL
    Newman          AKYAASTGQHVAVIEQSPKMYGGTCINIGCIPSKTLVHDGLEGKSFEASYNRKNDVVNAL
    USA300_FPR3757  AKYAASTGQHVAVIEQSPKMYGGTCINIGCIPSKTLVHDGLEGKSFEASYNRKNDVVNAL
                    *****************.******************************************

    COL             NNKNYHLLADDNNIDVLDFKAQFKSNTEVNLLDQHDDIVDSITAPHIIINTGATSVIPNI
    N315            NNKNYHLLADDNNIDVLDFKAQFKSNTEVNLLDQHGDIVDSITAPHIIINTGATSIIPNI
    NCTC8325        NNKNYHLLADDNNIDVLDFKAQFKSNTEVNLLDQHDDIVDSITAPHIIINTGATSVIPNI
    Newman          NNKNYHLLADDNNIDVLDFKAQFKSNTEVNLLDQHDDIVDSITAPHIIINTGATSVIPNI
    USA300_FPR3757  NNKNYHLLADDNNIDVLDFKAQFKSNTEVNLLDQHDDIVDSITAPHIIINTGATSVIPNI
                    ***********************************.*******************:****

    COL             KGLDQAKHVFDSTGLLNISYQPKHLVIVGGGYIALEFASMFANLGSKVTVLERGESFMPR
    N315            KGLDQAKHVFDSTGLLNISYQPKHLVIVGGGYIALEFASMFANLGSKVTVLERGESFMPR
    NCTC8325        KGLDQAKHVFDSTGLLNISYQPKHLVIVGGGYIALEFASMFANLGSKVTVLERGESFMPR
    Newman          KGLDQAKHVFDSTGLLNISYQPKHLVIVGGGYIALEFASMFANLGSKVTVLERGESFMPR
    USA300_FPR3757  KGLDQAKHVFDSTGLLNISYQPKHLVIVGGGYIALEFASMFANLGSKVTVLERGESFMPR
                    ************************************************************

    COL             EDQDVVAYGITDLENKGIALHTNVETTELSSDNHHTTVHTNVDNFEADAVLLAIGRKPNT
    N315            EDQDVVAHAITDLENKGIALHTNVETTELSSDDHHTTVRTNVGNFEADAVLLAIGRKPNT
    NCTC8325        EDQDVVAYGITDLENKGIALHTNVETTELSSDNHHTTVHTNVGNFEADAVLLAIGRKPNT
    Newman          EDQDVVAYGITDLENKGIALHTNVETTELSSDNHHTTVHTNVDNFEADAVLLAIGRKPNT
    USA300_FPR3757  EDQDVVAYGITDLENKGIALHTNVETTELSSDNHHTTVHTNVDNFEADAVLLAIGRKPNT
                    *******:.***********************:*****:***.*****************

    COL             DLALENTDIELGDRGEIKVNAHLQTTVPHIYAAGDVKGGLQFTYISLDDYRIIKSALYGN
    N315            ALALENTDIELGDRGEIKVNAQLQTSVPHIYAAGDVKGGLQFTYISLDDYRIIKSALYGN
    NCTC8325        DLALENTDIELGDRGEIKVNAHLQTTVPHIYAAGDVKGGLQFTYISLDDYRIIKSALYGN
    Newman          DLALENTDIELGDRGEIKVNAHLQTTVPHIYAAGDVKGGLQFTYISLDDYRIIKSALYGN
    USA300_FPR3757  DLALENTDIELGDRGEIKVNAHLQTTVPHIYAAGDVKGGLQFTYISLDDYRIIKSALYGN
                     ********************:***:**********************************

    COL             QSRTTDNRGSVPYTVFIDPPLSRVGLTSKEAAAQHYDYTEHQLLVSAIPRHKINNDPRGL
    N315            QSRTTDNRGSVPYTVFIDPPLSRVGLTSKEAAAQHYDYTEHQLLVSAIPRHKINNDPRGL
    NCTC8325        QSRTTDNRGSVPYTVFIDPPLSRVGLTSKEAAAQHYDYTEHQLLVSAIPRHKINNDPRGL
    Newman          QSRTTDNRGSVPYTVFIDPPLSRVGLTSKEAAAQHYDYTEHQLLVSAIPRHKINNDPRGL
    USA300_FPR3757  QSRTTDNRGSVPYTVFIDPPLSRVGLTSKEAAAQHYDYTEHQLLVSAIPRHKINNDPRGL
                    ************************************************************

    COL             FKVVINNENNMILGATLYGKQSEELINIIKLAIDQNIPYTVLRDNIYTHPTMAESFNDLF
    N315            FKVVINNENNMILGATLYGKQSEELINIIKLAIDQNIPYTVLRDNIYTHPTMAESFNDLF
    NCTC8325        FKVVINNENNMILGATLYGKQSEELINIIKLAIDQNIPYTVLRDNIYTHPTMAESFNDLF
    Newman          FKVVINNENNMILGATLYGKQSEELINIIKLAIDQNIPYTVLRDNIYTHPTMAESFNDLF
    USA300_FPR3757  FKVVINNENNMILGATLYGKQSEELINIIKLAIDQNIPYTVLRDNIYTHPTMAESFNDLF
                    ************************************************************

    COL             NF
    N315            NF
    NCTC8325        NF
    Newman          NF
    USA300_FPR3757  NF
                    **