From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002442000
  • symbol?:
  • description?: Phage protein

      descriptions from strain specific annotations:

    • Phage protein
    • transposase family protein
  • strand?: +
  • coordinates?: 2959608..2961036
  • synteny block?: BlockID0016800
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0573
    08BA02176:
    C248_0673
    11819-97:
    MS7_0647
    71193:
    ST398NM01_0670
    ECT-R 2:
    ECTR2_549
    ED133:
    SAOV_0631
    ED98:
    SAAV_0560
    HO 5096 0412:
    SAEMRSA15_05240
    JH1:
    SaurJH1_0634
    JH9:
    SaurJH9_0619
    JKD6008:
    SAA6008_00603
    JKD6159:
    SAA6159_00549
    LGA251:
    SARLGA251_05310
    M013:
    M013TW_0583
    MRSA252:
    SAR0602
    MSHR1132:
    SAMSHR1132_05400
    MSSA476:
    SAS0555
    Mu3:
    SAHV_0594
    Mu50:
    SAV0596
    MW2:
    MW0551
    RF122:
    SAB0546
    ST398:
    SAPIG0670
    T0131:
    SAT0131_00660
    TCH60:
    HMPREF0772_12591
    TW20:
    SATW20_06650
    USA300_TCH1516:
    USA300HOU_0591
    VC40:
    SAVC_02565

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSIDMYLDRSRNQASSVGNLSQTMNSNYDALEKAITQFINDDALKGKAYTSAKQFFSTVL
    N315            MSIDMYLDRSRNQASSVGNLSQTMNSNYDALEKAITQFINDDALKGKAYTSAKQFFSTVL
    NCTC8325        MSIDMYLDRSRNQASSVGNLSQTMNSNYDALEKAITQFINDDALKGKAYTSAKQFFSTVL
    Newman          MSIDMYLDRSRNQASSVGNLSQTMNSNYDALEKAITQFINDDALKGKAYTSAKQFFSTVL
    USA300_FPR3757  MSIDMYLDRSRNQASSVGNLSQTMNSNYDALEKAITQFINDDALKGKAYTSAKQFFSTVL
                    ************************************************************

    COL             IPLSTSMKTLSDLTKQACDNFVSRYTSEVDSISLKESELEEDIRSLSQQITRYENLNNNL
    N315            IPLSTSMKTLSDLTKQACDNFVSRYTSEVDSISLKESELEEDIRSLSQQITRYENLTNNL
    NCTC8325        IPLSTSMKTLSDLTKQACDNFVSRYTSEVDSISLKESELEEDIRSLSQQITRYENLNNNL
    Newman          IPLSTSMKTLSDLTKQACDNFVSRYTSEVDSISLKESELEEDIRSLSQQITRYENLNNNL
    USA300_FPR3757  IPLSTSMKTLSDLTKQACDNFVSRYTSEVDSISLKESELEEDIRSLSQQITRYENLNNNL
                    ********************************************************.***

    COL             KKHASDNQQAISSNQQIIRTLGQQKHELEEKLRKLREFNQKSPEIFKEVEEFQKIVQQGL
    N315            KKHASDNQQAISSNQQIIQTLGQQKHELEEKLRKLREFNQKSPEIFKEVEEFQKIVQQGL
    NCTC8325        KKHASDNQQAISSNQQIIRTLGQQKHELEEKLRKLREFNQKSPEIFKEVEEFQKIVQQGL
    Newman          KKHASDNQQAISSNQQIIRTLGQQKHELEEKLRKLREFNQKSPEIFKEVEEFQKIVQQGL
    USA300_FPR3757  KKHASDNQQAISSNQQIIRTLGQQKHELEEKLRKLREFNQKSPEIFKEVEEFQKIVQQGL
                    ******************:*****************************************

    COL             TQAQNFWNFSTNQFNIPSGKELDWAKASHEKYLKVAMGKIEHKAEKETLNKADFAVIKAY
    N315            TQAQNFWNFSTNQFNIPSGKELDWAKASHEKYLKVAMGKIEHKAEKETLNKADFAVIKAY
    NCTC8325        TQAQNFWNFSTNQFNIPSGKELDWAKASHEKYLKVAMGKIEHKAEKETLNKADFAVIKAY
    Newman          TQAQNFWNFSTNQFNIPSGKELDWAKASHEKYLKVAMGKIEHKAEKETLNKADFAVIKAY
    USA300_FPR3757  TQAQNFWNFSTNQFNIPSGKELDWAKASHEKYLKVAMGKIEHKAEKETLNKADFAVIKAY
                    ************************************************************

    COL             AKEHPEDDIPKSILKYINDNKDSIKRDIGLDITSTLLEQGGINASKFGVFINTAGGVKGP
    N315            AKEHPEDDIPKSIMKYINDNKDSIKRDIGLDITSTLLEQGGINASKFGVFINTAGGVKGP
    NCTC8325        AKEHPEDDIPKSILKYINDNKDSIKRDIGLDITSTLLEQDGINASKFGVFINTAGGVKGP
    Newman          AKEHPEDDIPKSILKYINDNKDSIKRDIGLDITSTLLEQGGINASKFGVFINTAGGVKGP
    USA300_FPR3757  AKEHPEDDIPKSILKYINDNKDSIKRDIGLDITSTLLEQGGINASKFGVFINTAGGVKGP
                    *************:*************************.********************

    COL             AGPNSFVEVKRTSGNVFIENGSKFAKGGKYLGKGVAGVGFGIGMYDDLANDDKTFGEALS
    N315            AGPNSFVEVKRTSGNVFIENGSKFAKGGKYLGKGVAGVGFGIGMYDDLANDNKTFGEALS
    NCTC8325        AGPNSFVEVKRTSGNVFIENGSKFAKGGKYLGKGVAGVGFGIGMYDDLANDDKTFGEALS
    Newman          AGPNSFVEVKRTSGNVFIENGSKFAKGGKYLGKGVAGVGFGIGMYDDLANDDKTFGEALS
    USA300_FPR3757  AGPNSFVEVKRTSGNVFIENGSKFAKGGKYLGKGVAGVGFGIGMYDDLANDDKTFGEALS
                    ***************************************************:********

    COL             HNGMTLAAGSAGTAVGAGLATFVLGSNPVGWVILAGLAMSTVFALGTDLIYQNNIFGLKD
    N315            HNGMTLAAGSV-----AAFGVAALVSNPVGWAVVGILTAGIIGSTVSDYLYQNNYFGIKD
    NCTC8325        HNGMTLAAGSAGTAVGAGLATFVLGSNPVGWVILAGLAMSTVFALGTDLIYQNNIFGLKD
    Newman          HNGMTLAAGSAGTAVGAGLATFVLGSNPVGWVILAGLAMSTVFALGTDLIYQNNIFGLKD
    USA300_FPR3757  HNGMTLAAGSAGTAVGAGLATFVLGSNPVGWVILAGLAMSTVFALGTDLIYQNNIFGLKD
                    **********.     *.:.. .* ******.::. *: . : :  :* :**** **:**

    COL             KVDWVGHKIDNSIDVVKKTTEKSMDSVGNAVSEAKNIISNHINPMKWAW
    N315            KVDWAGHKIDEGIDAVNKTAEKAVDSVGNAIGDATKSISNHINPMKWSW
    NCTC8325        KVDWVGHKIDNSIDVVKKTTEKSMDSVGNAVSEAKNIISNHINPMKWAW
    Newman          KVDWVGHKIDNSIDVVKKTTEKSMDSVGNAVSEAKNIISNHINPMKWAW
    USA300_FPR3757  KVDWVGHKIDNSIDVVKKTTEKSMDSVGNAVSEAKNIISNHINPMKWAW
                    ****.*****:.**.*:**:**::******:.:*.: **********:*