From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002445000
  • symbol?:
  • description?: pseudogene

      descriptions from strain specific annotations:

    • pseudogene
    • staphylococcus aureus paralogous family
    • membrane spanning protein
  • strand?: +
  • coordinates?: 2961037..2970982
  • synteny block?: BlockID0016830
  • occurrence?: in 69% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_0683
    11819-97:
    71193:
    ST398NM01_0680
    ECT-R 2:
    ED133:
    SAOV_0633
    ED98:
    HO 5096 0412:
    SAEMRSA15_05250
    JH1:
    JH9:
    JKD6008:
    SAA6008_00617
    JKD6159:
    SAA6159_00554
    LGA251:
    SARLGA251_05340
    M013:
    MRSA252:
    SAR0605
    MSHR1132:
    SAMSHR1132_05410
    MSSA476:
    SAS0567
    Mu3:
    Mu50:
    MW2:
    MW0562
    RF122:
    SAB0551
    ST398:
    SAPIG0680
    T0131:
    SAT0131_00666 (recX)
    TCH60:
    HMPREF0772_12588
    TW20:
    SATW20_06760
    USA300_TCH1516:
    USA300HOU_0605
    VC40:
    SAVC_02635

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLLCESKIINKNPKYRIIKYNDEYLMVDIISTWISLFFPFINWFIPKEYVKISREEFENL
    NCTC8325        MLLCESKIINKNPKYRIIKYNDEYLMVDIISTWISLFFPFINWFIPKEYVKISREEFENL
    Newman          MLLCESKIINKNQKYRIIKYNDEYLMVDIISTWISLFFPFINWFIPKEYVKISREEFENL
    USA300_FPR3757  MLLCESKIINKNPKYRIIKYNDEYLMVDIISTWISLFFPFINWFIPKEYVKISREEFENL
                    ************ ***********************************************

    COL             NIVKPAKKNVFWPVAGSSALLGVALRKYTHLLDIQLDKKLVIAICCITFIGILIFYVRLI
    NCTC8325        NIVKPAKKNVFWPVAGSSALLGVALRKYTHLLDIQLDKKLVIAICCITFIGILIFYVRLI
    Newman          NIVKPAKKNVFWPVAGSSALLGVALRKYTHLLDIQLDKKLVIAICCITFIGILIFYVRLI
    USA300_FPR3757  NIVKPAKKNVFWPVAGSSALLGVALRKYTHLLDIQLDKKLVIAICCITFIGILIFYVRLI
                    ************************************************************

    COL             KKSSLNIYNTKNKRSKIFLIPTLKNVCFTLFGYILFGGLTMLFLDALLSMSYQNIIVYFV
    NCTC8325        KKSSLNIYNTKNKRSKIFLIPTLKNVCFTLFGYILFGGLTMLFLDALLSMSYQNIIVYFV
    Newman          KKSSLNIYNTKNKRSKIFLIPTLKNVCFTLFGYILFGGLTMLFLDALLSMSYQNIIVYFV
    USA300_FPR3757  KKSSLNIYNTKNKRSKIFLIPTLKNVCFTLFGYILFGGLTMLFLDALLSMSYQNIIVYFV
                    ************************************************************

    COL             WIAVIMGFFLVNIALIIDKNIHVILKNQ
    NCTC8325        WIAVIMGFFLVNIALIIDKNIHVILKNQ
    Newman          WIAVIMGFFLVNIALIIDKNIHVILKNQ
    USA300_FPR3757  WIAVIMGFFLVNIALIIDKNIHVILKNQ
                    ****************************