From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002476000
  • symbol?:
  • description?: ABC transporter substrate-binding protein

      descriptions from strain specific annotations:

    • ABC transporter substrate-binding protein
    • iron compound ABC transporter iron compound-binding protein
    • iron compound ABC transporter substrate-binding protein
    • putative iron compound ABC transporter iron compound-binding protein
    • iron (Fe3+) ABC superfamily ATP binding cassette transporter, binding protein
    • Vitamin B12 ABC transporter, B12-binding component BtuF
    • Cobalamin-binding protein
    • iron (Fe3+) ABC transporter binding protein
    • iron-binding protein
    • iron-binding transport protein
    • iron compound ABC transporter, iron compound-binding protein, putative
    • periplasmic binding family protein
    • periplasmic binding protein
    • putative transport system lipoprotein
    • transport system lipoprotein
  • strand?: +
  • coordinates?: 2994231..2995118
  • synteny block?: BlockID0017120
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0586 (btuF)
    08BA02176:
    C248_0693
    11819-97:
    MS7_0662
    71193:
    ST398NM01_0690
    ECT-R 2:
    ECTR2_562
    ED133:
    SAOV_0645
    ED98:
    SAAV_0573
    HO 5096 0412:
    SAEMRSA15_05370
    JH1:
    SaurJH1_0647
    JH9:
    SaurJH9_0632
    JKD6008:
    SAA6008_00627
    JKD6159:
    SAA6159_00566
    LGA251:
    SARLGA251_05450
    M013:
    M013TW_0598
    MRSA252:
    SAR0618
    MSHR1132:
    SAMSHR1132_05530
    MSSA476:
    SAS0577
    Mu3:
    SAHV_0607
    Mu50:
    SAV0609
    MW2:
    MW0573
    RF122:
    SAB0562
    ST398:
    SAPIG0690
    T0131:
    SAT0131_00676
    TCH60:
    HMPREF0772_12577
    TW20:
    SATW20_06860
    USA300_TCH1516:
    USA300HOU_0615
    VC40:
    SAVC_02690

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKSLIAFILIFMLVLSGCGMKDNDKQGSNDNGSSKSPYHRIVSLMPSNTEILYELGLGK
    N315            MKKSLIAFILIFMLVLSGCGMKDNDKQGSDDNGSSKSPYHRIVSLMPSNTEILYELGLGK
    NCTC8325        --------------------MKDNDKQGSNDNGSSKSPYHRIVSLMPSNTEILYELGLGK
    Newman          MKKSLIAFILIFMLVLSGCGMKDNDKQGSNDNGSSKSPYHRIVSLMPSNTEILYELGLGK
    USA300_FPR3757  --------------------MKDNDKQGSNDNGSSKSPYHRIVSLMPSNTEILYELGLGK
                                        *********:******************************

    COL             YIVGVSTVDDYPKDVKKGKKQFDALNLNKEELLKAKPDLILAHESQKATANKVLSSLEKQ
    N315            YIVGVSTVDDYPKDVKEGKKQFDALNLNKEELLKAKPDLILAHESQKATANKVLSSLEKQ
    NCTC8325        YIVGVSTVDDYPKDVKKGKKQFDALNLNKEELLKAKPDLILAHESQKATANKVLSSLEKQ
    Newman          YIVGVSTVDDYPKDVKKGKKQFDALNLNKEELLKAKPDLILAHESQKATANKVLSSLEKQ
    USA300_FPR3757  YIVGVSTVDDYPKDVKKGKKQFDALNLNKEELLKAKPDLILAHESQKATANKVLSSLEKQ
                    ****************:*******************************************

    COL             GIKVVYVKDAQSIDETYNTFKQIGKLTHHDKQAEQLVEETKDNIDKVIDSIPAHHKKSKV
    N315            GIKVVYVKDAQSIDETYNTFKQIGKLTHHDKQAEQLVEETKDNIDKVIDSIPAHHKKSKV
    NCTC8325        GIKVVYVKDAQSIDETYNTFKQIGKLTHHDKQAEQLVEETKDNIDKVIDSIPAHHKKSKV
    Newman          GIKVVYVKDAQSIDETYNTFKQIGKLTHHDKQAEQLVEETKDNIDKVIDSIPAHHKKSKV
    USA300_FPR3757  GIKVVYVKDAQSIDETYNTFKQIGKLTHHDKQAEQLVEETKDNIDKVIDSIPAHHKKSKV
                    ************************************************************

    COL             FIEVSSKPEIYTAGKHTFFNDMLEKLEAQNVYSDINGWNPVTKESIIKKNPDILISTEAK
    N315            FIEVSSKPEIYTAGKHTFFNDMLEKLEAQNVYSDINGWNPVTKESIIKKNPDILISTEAK
    NCTC8325        FIEVSSKPEIYTAGKHTFFNDMLEKLEAQNVYSDINGWNPVTKESIIKKNPDILISTEAK
    Newman          FIEVSSKPEIYTAGKHTFFNDMLEKLEAQNVYSDINGWNPVTKESIIKKNPDILISTEAK
    USA300_FPR3757  FIEVSSKPEIYTAGKHTFFNDMLEKLEAQNVYSDINGWNPVTKESIIKKNPDILISTEAK
                    ************************************************************

    COL             TRSDYMDIIKKRGGFNKINAVKNTRIEVVNGDEVSRPGPRIDEGLKELRDAIYRK
    N315            TRSDYMDIIKKRGGFNKINAVKNTRIEVVNGDEVSRPGPRIDEGLKELRDAIYRK
    NCTC8325        TRSDYMDIIKKRGGFNKINAVKNTRIEVVNGDEVSRPGPRIDEGLKELRDAIYRK
    Newman          TRSDYMDIIKKRGGFNKINAVKNTRIEVVNGDEVSRPGPRIDEGLKELRDAIYRK
    USA300_FPR3757  TRSDYMDIIKKRGGFNKINAVKNTRIEVVNGDEVSRPGPRIDEGLKELRDAIYRK
                    *******************************************************