From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002477000
  • symbol?:
  • description?: iron ABC transporter permease

      descriptions from strain specific annotations:

    • iron ABC transporter permease
    • iron compound ABC transporter permease
    • fecCD transport family protein
    • iron (Fe3+) ABC superfamily ATP binding cassette transporter, membrane protein
    • Iron(III) dicitrate transport system permease protein fecD
    • iron (Fe3+) ABC transporter membrane protein
    • iron(III) ABC transporter permease
    • iron(III) ABC transporter permease protein
    • iron compound ABC transporter, permease protein
    • transport system permease
  • strand?: +
  • coordinates?: 2995226..2996224
  • synteny block?: BlockID0017130
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0587 (fecD)
    08BA02176:
    C248_0694
    11819-97:
    MS7_0663
    71193:
    ST398NM01_0691
    ECT-R 2:
    ECTR2_563
    ED133:
    SAOV_0646
    ED98:
    SAAV_0574
    HO 5096 0412:
    SAEMRSA15_05380
    JH1:
    SaurJH1_0648
    JH9:
    SaurJH9_0633
    JKD6008:
    SAA6008_00628
    JKD6159:
    SAA6159_00567
    LGA251:
    SARLGA251_05460
    M013:
    M013TW_0599
    MRSA252:
    SAR0619
    MSHR1132:
    SAMSHR1132_05540
    MSSA476:
    SAS0578
    Mu3:
    SAHV_0608
    Mu50:
    SAV0610
    MW2:
    MW0574
    RF122:
    SAB0563
    ST398:
    SAPIG0691
    T0131:
    SAT0131_00677
    TCH60:
    HMPREF0772_12576
    TW20:
    SATW20_06870
    USA300_TCH1516:
    USA300HOU_0616
    VC40:
    SAVC_02695

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTFNKVLLSWIVILIITTSIYLFWQLGDINDVFNQSILINVRLPRLLEALLTGMILTVAG
    N315            MTFNKVLLSWIVILIITTSIYLFWQLGDINDVFNQSILINVRLPRLLEALLTGMILTVAG
    NCTC8325        MTFNKVLLSWIVILIITTSIYLFWQLGDINDVFNQSILINVRLPRLLEALLTGMILTVAG
    Newman          MTFNKVLLSWIVILIITTSIYLFWQLGDINDVFNQSILINVRLPRLLEALLTGMILTVAG
    USA300_FPR3757  MTFNKVLLSWIVILIITTSIYLFWQLGDINDVFNQSILINVRLPRLLEALLTGMILTVAG
                    ************************************************************

    COL             LIFQTVLNNALADSFTLGLASGATFGSGLALFLGLTTLWIPVFSITFSLITLITVLVITS
    N315            LIFQTVLNNALADSFTLGLASGATFGSGLALFLGLTTLWIPVFSITFSLITLITVLVITS
    NCTC8325        LIFQTVLNNALADSFTLGLASGATFGSGLALFLGLTTLWIPVFSITFSLITLITVLVITS
    Newman          LIFQTVLNNALADSFTLGLASGATFGSGLALFLGLTTLWIPVFSITFSLITLITVLVITS
    USA300_FPR3757  LIFQTVLNNALADSFTLGLASGATFGSGLALFLGLTTLWIPVFSITFSLITLITVLVITS
                    ************************************************************

    COL             VLSQGYPVRILILSGLMIGALFNSLLYFLILLKPRKLNTIANYLFGGFGDAEYSNVSIIA
    N315            VLSQGYPVRILILSGLMIGALFNSLLYFLILLKPRKLNTIANYLFGGFGDAEYSNVSIIA
    NCTC8325        VLSQGYPVRILILSGLMIGALFNSLLYFLILLKPRKLNTIANYLFGGFGDAEYSNVSIIA
    Newman          VLSQGYPVRILILSGLMIGALFNSLLYFLILLKPRKLNTIANYLFGGFGDAEYSNVSIIA
    USA300_FPR3757  VLSQGYPVRILILSGLMIGALFNSLLYFLILLKPRKLNTIANYLFGGFGDAEYSNVSIIA
                    ************************************************************

    COL             ITFIIALFGIFIILNQLKLLQLGELKSQSLGLNVQLITYIALCIASMITAINVAYVGIIG
    N315            ITFIIALFGIFIILNQLKLLQLGELKSQSLGLNVQLITYIALCIASMITAINVAYVGIIG
    NCTC8325        ITFIIALFGIFIILNQLKLLQLGELKSQSLGLNVQLITYIALCIASMITAINVAYVGIIG
    Newman          ITFIIALFGIFIILNQLKLLQLGELKSQSLGLNVQLITYIALCIASMITAINVAYVGIIG
    USA300_FPR3757  ITFIIALFGIFIILNQLKLLQLGELKSQSLGLNVQLITYIALCIASMITAINVAYVGIIG
                    ************************************************************

    COL             FIGMVIPQLIRKWQWKQSLGRQLALNIVTGGQIMVMADFIGSHILSPVQIPASIIIALIG
    N315            FIGMVIPQLIRKWQWKQSLGRQLALNIVIGGQIMVMADFIGSHILSPVQIPASIIIALIG
    NCTC8325        FIGMVIPQLIRKWQWKQSLGRQLALNIVTGGQIMVMADFIGSHILSPVQIPASIIIALIG
    Newman          FIGMVIPQLIRKWQWKQSLGRQLALNIVTGGQIMVMADFIGSHILSPVQIPASIIIALIG
    USA300_FPR3757  FIGMVIPQLIRKWQWKQSLGRQLALNIVTGGQIMVMADFIGSHILSPVQIPASIIIALIG
                    **************************** *******************************

    COL             IPVLFYMLISQSKRLH
    N315            IPVLFYMLISQSKRLH
    NCTC8325        IPVLFYMLISQSKRLH
    Newman          IPVLFYMLISQSKRLH
    USA300_FPR3757  IPVLFYMLISQSKRLH
                    ****************