From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002478000
  • symbol?:
  • description?: HAD family hydrolase

      descriptions from strain specific annotations:

    • HAD family hydrolase
    • HAD superfamily hydrolase
    • haloacid dehalogenase-like hydrolase
    • HAD hydrolase family protein
    • haloacid dehalogenase
    • haloacid dehalogenase hydrolase
    • haloacid dehalogenase-like family hydrolase
    • L-2-haloalkanoic acid dehalogenase
  • strand?: +
  • coordinates?: 2996279..2996998
  • synteny block?: BlockID0017140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0588
    08BA02176:
    C248_0695
    11819-97:
    MS7_0664
    71193:
    ST398NM01_0692
    ECT-R 2:
    ECTR2_564
    ED133:
    SAOV_0647
    ED98:
    SAAV_0575
    HO 5096 0412:
    SAEMRSA15_05390
    JH1:
    SaurJH1_0649
    JH9:
    SaurJH9_0634
    JKD6008:
    SAA6008_00629
    JKD6159:
    SAA6159_00568
    LGA251:
    SARLGA251_05470
    M013:
    M013TW_0600
    MRSA252:
    SAR0620
    MSHR1132:
    SAMSHR1132_05550
    MSSA476:
    SAS0579
    Mu3:
    SAHV_0609
    Mu50:
    SAV0611
    MW2:
    MW0575
    RF122:
    SAB0564
    ST398:
    SAPIG0692
    T0131:
    SAT0131_00678 (vraS)
    TCH60:
    HMPREF0772_12575
    TW20:
    SATW20_06880
    USA300_TCH1516:
    USA300HOU_0617
    VC40:
    SAVC_02700

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDLNQIKAVVFDLEGTLLDRVKSREKFIEEQYERFHDYLIHVQLADFKKAFIELDDDEDN
    N315            MDLNQIKAVVFDLEGTLLDRVKSREKFIEEQYERFHDYLIHVQLADFKKAFIELDDDEDN
    NCTC8325        MDLNQIKAVVFDLEGTLLDRVKSREKFIEEQYERFHDYLIHVQLADFKKAFIELDDDEDN
    Newman          MDLNQIKAVVFDLEGTLLDRVKSREKFIEEQYERFHDYLIHVQLADFKKAFIELDDDEDN
    USA300_FPR3757  MDLNQIKAVVFDLEGTLLDRVKSREKFIEEQYERFHDYLIHVQLADFKKAFIELDDDEDN
                    ************************************************************

    COL             DKPDLYKEIIKRFHVDRLTWKDLFNDFEMHFYRYVFPYYDTLYTLEKLSQKGFQIGVIAN
    N315            DKPDLYKEIIKRFHVDRLTWKDLFNDFEMHFYRYVFPYYDTLYTLEKLSQKGFQIGVIAN
    NCTC8325        DKPDLYKEIIKRFHVDRLTWKDLFNDFEMHFYRYVFPYYDTLYTLEKLSQKGFQIGVIAN
    Newman          DKPDLYKEIIKRFHVDRLTWKDLFNDFEMHFYRYVFPYYDTLYTLEKLSQKGFQIGVIAN
    USA300_FPR3757  DKPDLYKEIIKRFHVDRLTWKDLFNDFEMHFYRYVFPYYDTLYTLEKLSQKGFQIGVIAN
                    ************************************************************

    COL             GKSKIKQFRLHSLGLMHVINYLSTSETVGFRKPHPKIFEDMIDQLGVLPEQIMYVGDDAL
    N315            GKSKIKQFRLHSLGLMHVINYLSTSETVGFRKPHPKIFEDMIDQLGVLPEQIMYVGDDAL
    NCTC8325        GKSKIKQFRLHSLGLMHVINYLSTSETVGFRKPHPKIFEDMIDQLGVLPEQIMYVGDDAL
    Newman          GKSKIKQFRLHSLGLMHVINYLSTSETVGFRKPHPKIFEDMIDQLGVLPEQIMYVGDDAL
    USA300_FPR3757  GKSKIKQFRLHSLGLMHVINYLSTSETVGFRKPHPKIFEDMIDQLGVLPEQIMYVGDDAL
                    ************************************************************

    COL             NDVAPARAMGMVSVWYKQEDAEIEPLEEEVDFTITTVEELLTILPIKNDNKGENYGSIY
    N315            NDVAPARAMGMVSVWYKQEDAEIEPLEEEVDFTITTVEELLTILPIKNDNKGENYGSIY
    NCTC8325        NDVAPARAMGMVSVWYKQEDAEIEPLEEEVDFTITTVEELLTILPIKNDNKGENYGSIY
    Newman          NDVAPARAMGMVSVWYKQEDAEIEPLEEEVDFTITTVEELLTILPIKNDNKGENYGSIY
    USA300_FPR3757  NDVAPARAMGMVSVWYKQEDAEIEPLEEEVDFTITTVEELLTILPIKNDNKGENYGSIY
                    ***********************************************************