From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002479000
  • symbol?:
  • description?: alpha/beta hydrolase

      descriptions from strain specific annotations:

    • alpha/beta hydrolase
    • alpha/beta fold family hydrolase
    • hydrolase
    • Alpha/beta hydrolase fold family hydrolase
    • 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
    • 3-oxoadipate enol-lactonase
    • alpha/beta hydrolase fold family protein
    • hydrolase, alpha/beta hydrolase fold family
    • putative hydrolase
  • strand?: +
  • coordinates?: 2996961..2997782
  • synteny block?: BlockID0017150
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0589
    08BA02176:
    C248_0696
    11819-97:
    MS7_0665
    71193:
    ST398NM01_0693
    ECT-R 2:
    ECTR2_565
    ED133:
    SAOV_0648
    ED98:
    SAAV_0576
    HO 5096 0412:
    SAEMRSA15_05400
    JH1:
    SaurJH1_0650
    JH9:
    SaurJH9_0635
    JKD6008:
    SAA6008_00630
    JKD6159:
    SAA6159_00569
    LGA251:
    SARLGA251_05480
    M013:
    M013TW_0601
    MRSA252:
    SAR0621
    MSHR1132:
    SAMSHR1132_05560
    MSSA476:
    SAS0580
    Mu3:
    SAHV_0610
    Mu50:
    SAV0612
    MW2:
    MW0576
    RF122:
    SAB0565
    ST398:
    SAPIG0693
    T0131:
    SAT0131_00679
    TCH60:
    HMPREF0772_12574
    TW20:
    SATW20_06890
    USA300_TCH1516:
    USA300HOU_0618
    VC40:
    SAVC_02705

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDLFTRKDGTSIHYSTLGEGYPIVLIHTVLDNYSVFNKLAAELAKSFQVVLIDLRGHGYS
    N315            MDLFTRKDGTSIHYSTLGEGYPIVLIHTVLDNYSVFNKLAAQLAKSFQVVLIDLRGHGYS
    NCTC8325        MDLFTRKDGTSIHYSTLGEGYPIVLIHTVLDNYSVFNKLAAELAKSFQVVLIDLRGHGYS
    Newman          MDLFTRKDGTSIHYSTLGEGYPIVLIHTVLDNYSVFNKLAAELAKSFQVVLIDLRGHGYS
    USA300_FPR3757  MDLFTRKDGTSIHYSTLGEGYPIVLIHTVLDNYSVFNKLAAELAKSFQVVLIDLRGHGYS
                    *****************************************:******************

    COL             DKPRHIEIKDFSDDIVELLKYLYIEEVAFVCHEMGGIIGADISVRYPEFTSSLTLVNPTS
    N315            DKPRHIEIKDFSDDIVELLKYLYIEEVAFVCHEMGGIIGADISVRYPEFTSSLMLVNPTS
    NCTC8325        DKPRHIEIKDFSDDIVELLKYLYIEEVAFVCHEMGGIIGADISVRYPEFTSSLTLVNPTS
    Newman          DKPRHIEIKDFSDDIVELLKYLYIEEVAFVCHEMGGIIGADISVRYPEFTSSLTLVNPTS
    USA300_FPR3757  DKPRHIEIKDFSDDIVELLKYLYIEEVAFVCHEMGGIIGADISVRYPEFTSSLTLVNPTS
                    ***************************************************** ******

    COL             IEGELPEERLFRKYAHIIRNWDPEKQDKFLNKRKYYRPRKMNRFLKHVVDTNEISTKEEI
    N315            IEGELPEERLFRKYAHIIRNWDPEKQDKFLNKRKYYRPRKMNRFLKHVVDTNEISTKEEI
    NCTC8325        IEGELPEERLFRKYAHIIRNWDPEKQDKFLNKRKYYRPRKMNRFLKHVVDTNEISTKEEI
    Newman          IEGELPEERLFRKYAHIIRNWDPEKQDKFLNKRKYYRPRKMNRFLKHVVDTNEISTKEEI
    USA300_FPR3757  IEGELPEERLFRKYAHIIRNWDPEKQDKFLNKRKYYRPRKMNRFLKHVVDTNEISTKEEI
                    ************************************************************

    COL             QAVKEVFKNADISQTYRNVVVPTKIIAGEFGERTTRLEAKEVADLIQNADFEVYQESSAF
    N315            QAVKEVFKNADISQTYRNVVVPTKIIAGEFGERTTRLEAKEVADLIQNADFEVYQESSAF
    NCTC8325        QAVKEVFKNADISQTYRNVVVPTKIIAGEFGERTTRLEAKEVADLIQNADFEVYQESSAF
    Newman          QAVKEVFKNADISQTYRNVVVPTKIIAGEFGERTTRLEAKEVADLIQNADFEVYQESSAF
    USA300_FPR3757  QAVKEVFKNADISQTYRNVVVPTKIIAGEFGERTTRLEAKEVADLIQNADFEVYQESSAF
                    ************************************************************

    COL             PFVEEQERFVEDTAAFINKHHDEKHV
    N315            PFVEEQERFVEDIASFINKHHDEKHV
    NCTC8325        PFVEEQERFVEDTAAFINKHHDEKHV
    Newman          PFVEEQERFVEDTAAFINKHHDEKHV
    USA300_FPR3757  PFVEEQERFVEDTAAFINKHHDEKHV
                    ************ *:***********