From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002493000
  • symbol?: mnhA2
  • description?: monovalent cation/H+ antiporter subunit A

      descriptions from strain specific annotations:

    • monovalent cation/H+ antiporter subunit A
    • putative monovalent cation/H+ antiporter subunit A
    • Na(+) H(+) antiporter subunit A
    • NADH-Ubiquinone/plastoquinone (complex I), various chains family protein
    • putative NADH-Ubiquinone/plastoquinone (complexI) oxidoreductase protein
    • monovalent cation/H+ antiporter subunit A, MnhA_1
    • Putative antiporter subunit mnhA2
    • Na(+)/H(+) antiporter subunit A
    • Na+/H+ antiporter, MnhA component, putative
    • CPA3 family monovalent cation (K+ or Na+):proton (H+) antiporter-3 MnhA subunit
    • Na(+)/H(+) antiporter subunit A (Multiple resistance and pHhomeostasis protein A) (Mrp complex subunit A)
    • ShaA
    • NADH Ubiquinone plastoquinone complex I oxidoreductase protein
  • strand?: +
  • coordinates?: 3006056..3007502
  • synteny block?: BlockID0017290
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0593 (mnhA)
    USA300_FPR3757:
    04-02981:
    SA2981_0598
    08BA02176:
    C248_0705
    11819-97:
    MS7_0674 (mrpA)
    71193:
    ST398NM01_0702
    ECT-R 2:
    ECTR2_574
    ED133:
    SAOV_0658
    ED98:
    SAAV_0586
    HO 5096 0412:
    SAEMRSA15_05490
    JH1:
    SaurJH1_0660
    JH9:
    SaurJH9_0645
    JKD6008:
    SAA6008_00640 (mnh_A1)
    JKD6159:
    SAA6159_00578 (mnh_A1)
    LGA251:
    SARLGA251_05570
    M013:
    M013TW_0610
    MRSA252:
    SAR0630
    MSHR1132:
    SAMSHR1132_05660
    MSSA476:
    SAS0589
    Mu3:
    SAHV_0619
    Mu50:
    SAV0621
    MW2:
    MW0585
    RF122:
    SAB0573
    ST398:
    SAPIG0702
    T0131:
    SAT0131_00690 (ftn)
    TCH60:
    HMPREF0772_12566 (mnhA2)
    TW20:
    SATW20_06980
    USA300_TCH1516:
    USA300HOU_0643 (mnhA1)
    VC40:
    SAVC_02750

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSLVYLLIAILVIMAMILLMSKRRALAKYAGYIALVAPVISSIYFLIQIPSVAKLQYLST
    N315            MSLVYLLIAILVIMAMILLMSKRRALAKYAGYIALVAPVISSIYFLIQIPSVAKLQYLST
    NCTC8325        MSLVYLLIAILVIMAMILLMSKRRALAKYAGYIALVAPVISSIYFLIQIPSVAKLQYLST
    Newman          MSLVYLLIAILVIMAMILLMSKRRALAKYAGYIALVAPVISSIYFLIQIPSVAKLQYLST
    USA300_FPR3757  MSLVYLLIAILVIMAMILLMSKRRALAKYAGYIALVAPVISSIYFLIQIPSVAKLQYLST
                    ************************************************************

    COL             SIPWIKTLDINLDLRLDGLSLMFSLIISLIGIAVFFYATQYLSSRKDNLPRFYFYLTLFM
    N315            SIPWIKTLDINLDLRLDGLSLMFSLIISLIGIAVFFYATQYLSSRKDNLPRFYFYLTLFM
    NCTC8325        SIPWIKTLDINLDLRLDGLSLMFSLIISLIGIAVFFYATQYLSSRKDNLPRFYFYLTLFM
    Newman          SIPWIKTLDINLDLRLDGLSLMFSLIISLIGIAVFFYATQYLSSRKDNLPRFYFYLTLFM
    USA300_FPR3757  SIPWIKTLDINLDLRLDGLSLMFSLIISLIGIAVFFYATQYLSSRKDNLPRFYFYLTLFM
                    ************************************************************

    COL             FSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGAIQSFMITVFGGLALLVG
    N315            FSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGAIQSFMITVFGGLALLVG
    NCTC8325        FSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGAIQSFMITVFGGLALLVG
    Newman          FSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGAIQSFMITVFGGLALLVG
    USA300_FPR3757  FSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGAIQSFMITVFGGLALLVG
                    ************************************************************

    COL             FIMLYIMTGTNNITEILGQADHIKNHGLFIPMIFMFLLGAFTKSAQFPFHIWLPRAMAAP
    N315            FIMLYIMTGTNNITDILGQADHIKNHGLFIPMIFMFLLGAFTKSAQFPFHIWLPRAMAAP
    NCTC8325        FIMLYIMTGTNNITEILGQADHIKNHGLFIPMIFMFLLGAFTKSAQFPFHIWLPRAMAAP
    Newman          FIMLYIMTGTNNITEILGQADHIKNHGLFIPMIFMFLLGAFTKSAQFPFHIWLPRAMAAP
    USA300_FPR3757  FIMLYIMTGTNNITEILGQADHIKNHGLFIPMIFMFLLGAFTKSAQFPFHIWLPRAMAAP
                    **************:*********************************************

    COL             TPVSAYLHSATMVKAGIFLLLRFTPLLGLSNMYVYIVTFVGLITMLFGSITALKQWDLKG
    N315            TPVSAYLHSATMVKAGIFLLLRFTPLLGLSNMYIYIVTFVGLITMLFGSITALKQWDLKG
    NCTC8325        TPVSAYLHSATMVKAGIFLLLRFTPLLGLSNMYVYIVTFVGLITMLFGSITALKQWDLKG
    Newman          TPVSAYLHSATMVKAGIFLLLRFTPLLGLSNMYVYIVTFVGLITMLFGSITALKQWDLKG
    USA300_FPR3757  TPVSAYLHSATMVKAGIFLLLRFTPLLGLSNMYVYIVTFVGLITMLFGSITALKQWDLKG
                    *********************************:**************************

    COL             ILAYSTISQLGMIMAMVGIGGGYAQHQQDAIASIYVFVLFGALFHLMNHAIFKCALFMGV
    N315            ILAYSTISQLGMIMAMVGIGGGYAQHQQDAIASIYVFVLFGALFHLMNHAIFKCALFMGV
    NCTC8325        ILAYSTISQLGMIMAMVGIGGGYAQHQQDAIASIYVFVLFGALFHLMNHAIFKCALFMGV
    Newman          ILAYSTISQLGMIMAMVGIGGGYAQHQQDAIASIYVFVLFGALFHLMNHAIFKCALFMGV
    USA300_FPR3757  ILAYSTISQLGMIMAMVGIGGGYAQHQQDAIASIYVFVLFGALFHLMNHAIFKCALFMGV
                    ************************************************************

    COL             GILDHEAGSRDIRILSGMRQLFPKMNLVMTIAALSMAGVPFLNGFLSKEMFLDALTQTGQ
    N315            GILDHEAGSRDIRILSGMRQLFPKMNLVMTIAALSMAGVPFLNGFLSKEMFLDALTQTGQ
    NCTC8325        GILDHEAGSRDIRILSGMRQLFPKMNLVMTIAALSMAGVPFLNGFLSKEMFLDALTQTGQ
    Newman          GILDHEAGSRDIRILSGMRQLFPKMNLVMTIAALSMAGVPFLNGFLSKEMFLDALTQTGQ
    USA300_FPR3757  GILDHEAGSRDIRILSGMRQLFPKMNLVMTIAALSMAGVPFLNGFLSKEMFLDALTQTGQ
                    ************************************************************

    COL             LSQFSLISMIAIVFVGVIASVFTFTYALYMVKEVFWTKYDSKVFTKKNIHEPWLFSLPSL
    N315            LSQFSLISMIAIVFVGVIASIFTFTYALYMVKEVFWTKYDSKVFTKKNIHEPWLFSLPSL
    NCTC8325        LSQFSLISMIAIVFVGVIASVFTFTYALYMVKEVFWTKYDSKVFTKKNIHEPWLFSLPSL
    Newman          LSQFSLISMIAIVFVGVIASVFTFTYALYMVKEVFWTKYDSKVFTKKNIHEPWLFSLPSL
    USA300_FPR3757  LSQFSLISMIAIVFVGVIASVFTFTYALYMVKEVFWTKYDSKVFTKKNIHEPWLFSLPSL
                    ********************:***************************************

    COL             ILMVLVPVIFFVPNIFGKGIIVLALRAVSGGNHQIDQLAPHVSQWHGFNIPLLLTIIIIL
    N315            ILMVLVPVIFFVPNIFGKGIIVPALRGVSGGNHQIDPLAPHVSQWHGFNIPLLLTIIIIL
    NCTC8325        ILMVLVPVIFFVPNIFGKGIIVLALRAVSGGNHQIDQLAPHVSQWHGFNIPLLLTIIIIL
    Newman          ILMVLVPVIFFVPNIFGKGIIVLALRAVSGGNHQIDQLAPHVSQWHGFNIPLLLTIIIIL
    USA300_FPR3757  ILMVLVPVIFFVPNIFGKGIIVLALRAVSGGNHQIDQLAPHVSQWHGFNIPLLLTIIIIL
                    ********************** ***.********* ***********************

    COL             LGSVLAIKVDWKKVFTGKIRQISVSKSYEMVYRHFEKFATKRFKRVMQDRLNQYIIMTLG
    N315            LGSVLAIKVDWKKVFTGKIRQISVSKGYEMVYRHFEKFATKRFKRVMQDRLNQYIIMTLG
    NCTC8325        LGSVLAIKVDWKKVFTGKIRQISVSKSYEMVYRHFEKFATKRFKRVMQDRLNQYIIMTLG
    Newman          LGSVLAIKVDWKKVFTGKIRQISVSKSYEMVYRHFEKFATKRFKRVMQDRLNQYIIMTLG
    USA300_FPR3757  LGSVLAIKVDWKKVFTGKIRQISVSKSYEMVYRHFEKFATKRFKRVMQDRLNQYIIMTLG
                    **************************.*********************************

    COL             IFMIIIGYGYIRIGLPKVHQLHVSEFGALEIILAIVTVTIGISLIFIRQRLTMVILNGVI
    N315            IFMIIIGYGYIRIGLPKVHQLHVSEFGALEIILAIVTVTIGISLIFIRQRLTMVILNGVI
    NCTC8325        IFMIIIGYGYIRIGLPKVHQLHVSEFGALEIILAIVTVTIGISLIFIRQRLTMVILNGVI
    Newman          IFMIIIGYGYIRIGLPKVHQLHVSEFGALEIILAIVTVTIGISLIFIRQRLTMVILNGVI
    USA300_FPR3757  IFMIIIGYGYIRIGLPKVHQLHVSEFGALEIILAIVTVTIGISLIFIRQRLTMVILNGVI
                    ************************************************************

    COL             GFVVTLFFIAMKAPDLALTQLVVETITTILFIVSFSRLPNVPRSNANKKREIIKISVSLL
    N315            GFVVTLFFIAMKAPDLALTQLVVETITTILFIVSFSRLPNVPRSNANKKREIIKISVSLL
    NCTC8325        GFVVTLFFIAMKAPDLALTQLVVETITTILFIVSFSRLPNVPRSNANKKREIIKISVSLL
    Newman          GFVVTLFFIAMKAPDLALTQLVVETITTILFIVSFSRLPNVPRSNANKKREIIKISVSLL
    USA300_FPR3757  GFVVTLFFIAMKAPDLALTQLVVETITTILFIVSFSRLPNVPRSNANKKREIIKISVSLL
                    ************************************************************

    COL             MALIVVSLIFITQQTDGLSSISDFYLKADKLTGGKNIVNAILGDFRALDTLFEGLVLIIT
    N315            MALIVVSLIFITQQTDGLSSISDFYLKADKLTGGKNIVNAILGDFRALDTLFEGLVLIIT
    NCTC8325        MALIVVSLIFITQQTDGLSSISDFYLKADKLTGGKNIVNAILGDFRALDTLFEGLVLIIT
    Newman          MALIVVSLIFITQQTDGLSSISDFYLKADKLTGGKNIVNAILGDFRALDTLFEGLVLIIT
    USA300_FPR3757  MALIVVSLIFITQQTDGLSSISDFYLKADKLTGGKNIVNAILGDFRALDTLFEGLVLIIT
                    ************************************************************

    COL             GLGIYTLLNYQDRRGQDERE
    N315            GLGIYTLLNYQDRRGQDERE
    NCTC8325        GLGIYTLLNYQDRRGQDERE
    Newman          GLGIYTLLNYQDRRGQDERE
    USA300_FPR3757  GLGIYTLLNYQDRRGQDERE
                    ********************