From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002497000
  • symbol?: mnhD2
  • description?: monovalent cation/H+ antiporter subunit D

      descriptions from strain specific annotations:

    • monovalent cation/H+ antiporter subunit D
    • putative monovalent cation/H+ antiporter subunit D
    • Na(+) H(+) antiporter subunit D
    • NADH-Ubiquinone/plastoquinone (complex I), various chains family protein
    • putative NADH-Ubiquinone/plastoquinone (complexI) oxidoreductase protein
    • Putative antiporter subunit mnhD2
    • monovalent cation antiporter-3, MnhD_1
    • CPA3 family monovalent cation (K+ or Na+):proton (H+) antiporter-3, MnhD subunit
    • MrpD
    • NADH Ubiquinone plastoquinone complex I oxidoreductase protein
  • strand?: +
  • coordinates?: 3009198..3010697
  • synteny block?: BlockID0017330
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0596 (mnhD)
    USA300_FPR3757:
    04-02981:
    SA2981_0601
    08BA02176:
    C248_0708 (mnhD1)
    11819-97:
    MS7_0677
    71193:
    ST398NM01_0705
    ECT-R 2:
    ECTR2_577
    ED133:
    SAOV_0661
    ED98:
    SAAV_0589
    HO 5096 0412:
    SAEMRSA15_05520
    JH1:
    SaurJH1_0663
    JH9:
    SaurJH9_0648
    JKD6008:
    SAA6008_00643 (mnhD_1)
    JKD6159:
    SAA6159_00581 (mnhD_1)
    LGA251:
    SARLGA251_05600
    M013:
    M013TW_0614
    MRSA252:
    SAR0633
    MSHR1132:
    SAMSHR1132_05690
    MSSA476:
    SAS0592
    Mu3:
    SAHV_0622
    Mu50:
    SAV0625
    MW2:
    MW0588
    RF122:
    SAB0576
    ST398:
    SAPIG0705
    T0131:
    SAT0131_00693
    TCH60:
    HMPREF0772_12563 (mnhD2)
    TW20:
    SATW20_07010
    USA300_TCH1516:
    USA300HOU_0646 (mnhD1)
    VC40:
    SAVC_02765

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLSNLLILPMLLPFLCALILVFLKNNDRISKYLYLGTMTITTIISLMLLIYVQRHRPITL
    N315            MLSNLLILPMLLPFLCALILVFLKNNDRISKYLYLGTMTITTIISLMLLIYVQRHRPITL
    NCTC8325        MLSNLLILPMLLPFLCALILVFLKNNDRISKYLYLGTMTITTIISLMLLIYVQRHRPITL
    Newman          MLSNLLILPMLLPFLCALILVFLKNNDRISKYLYLGTMTITTIISLMLLIYVQRHRPITL
    USA300_FPR3757  MLSNLLILPMLLPFLCALILVFLKNNDRISKYLYLGTMTITTIISLMLLIYVQRHRPITL
                    ************************************************************

    COL             DFGGWSAPFGIQFLGDSLSLIMVTTASFVITLIMAYGFGRGEHKANRYHLPSFILFLSVG
    N315            DFGGWSAPFGIQFLGDSLSLIMVTTASFVITLIMAYGFGRGEHKANRYHLPSFILFLSVG
    NCTC8325        DFGGWSAPFGIQFLGDSLSLIMVTTASFVITLIMAYGFGRGEHKANRYHLPSFILFLSVG
    Newman          DFGGWSAPFGIQFLGDSLSLIMVTTASFVITLIMAYGFGRGEHKANRYHLPSFILFLSVG
    USA300_FPR3757  DFGGWSAPFGIQFLGDSLSLIMVTTASFVITLIMAYGFGRGEHKANRYHLPSFILFLSVG
                    ************************************************************

    COL             VIGSFLTSDLFNLYVMFEIMLLASFVLITLGQSVEQLRAAIIYVVLNIIGSWLFLLGIGL
    N315            VIGSFLTSDLFNLYVMFEIMLLASFVLITLGQSVEQLRAAIIYVVLNIIGSWLFLLGIGL
    NCTC8325        VIGSFLTSDLFNLYVMFEIMLLASFVLITLGQSVEQLRAAIIYVVLNIIGSWLFLLGIGL
    Newman          VIGSFLTSDLFNLYVMFEIMLLASFVLITLGQSVEQLRAAIIYVVLNIIGSWLFLLGIGL
    USA300_FPR3757  VIGSFLTSDLFNLYVMFEIMLLASFVLITLGQSVEQLRAAIIYVVLNIIGSWLFLLGIGL
                    ************************************************************

    COL             LYKTVGTLNFSHIAMRLNDMGDNRTVTMISLIFLVAFSAKAALVLFMWLPKAYAVLNTEL
    N315            LYKTVGTLNFSHIAMRLNDMGDNRTVTMISLIFLVAFSAKAALVLFMWLPKAYAVLNTEL
    NCTC8325        LYKTVGTLNFSHIAMRLNDMGDNRTVTMISLIFLVAFSAKAALVLFMWLPKAYAVLNTEL
    Newman          LYKTVGTLNFSHIAMRLNDMGDNRTVTMISLIFLVAFSAKAALVLFMWLPKAYAVLNTEL
    USA300_FPR3757  LYKTVGTLNFSHIAMRLNDMGDNRTVTMISLIFLVAFSAKAALVLFMWLPKAYAVLNTEL
                    ************************************************************

    COL             AALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAAITMVIGAIGVIAYKDIKKIA
    N315            AALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAAITMVIGAIGVIAYKDIKKIA
    NCTC8325        AALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAAITMVIGAIGVIAYKDIKKIA
    Newman          AALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAAITMVIGAIGVIAYKDIKKIA
    USA300_FPR3757  AALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAAITMVIGAIGVIAYKDIKKIA
                    ************************************************************

    COL             AYQVIISIGFIILGLGTNTFAGINGAIFYLVNDIVVKTLLFFIIGSLVYITGYRQYQYLN
    N315            AYQVIISIGFIILGLGTNTFAGINGAIFYLVNDIVVKTLLFFIIGSLVYITGYRQYQYLN
    NCTC8325        AYQVIISIGFIILGLGTNTFAGINGAIFYLVNDIVVKTLLFFIIGSLVYITGYRQYQYLN
    Newman          AYQVIISIGFIILGLGTNTFAGINGAIFYLVNDIVVKTLLFFIIGSLVYITGYRQYQYLN
    USA300_FPR3757  AYQVIISIGFIILGLGTNTFAGINGAIFYLVNDIVVKTLLFFIIGSLVYITGYRQYQYLN
                    ************************************************************

    COL             GLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGALQNGNYIGLALMIITSLIAMY
    N315            GLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGALQNGNYIGLALMIITSLIAMY
    NCTC8325        GLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGALQNGNYIGLALMIITSLIAMY
    Newman          GLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGALQNGNYIGLALMIITSLIAMY
    USA300_FPR3757  GLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGALQNGNYIGLALMIITSLIAMY
                    ************************************************************

    COL             SLFRILFYMYFGDKDGEEVNFKKIPLYRKRILSILVVVVIAIGIAAPVVLNVTSDATELN
    N315            SLFRIFFYMYFGDKDGEEVNFKKIPLYRKRILSILVVVVIAIGIAAPVVLNVTSDATELN
    NCTC8325        SLFRILFYMYFGDKDGEEVNFKKIPLYRKRILSILVVVVIAIGIAAPVVLNVTSDATELN
    Newman          SLFRILFYMYFGDKDGEEVNFKKIPLYRKRILSILVVVVIAIGIAAPVVLNVTSDATELN
    USA300_FPR3757  SLFRILFYMYFGDKDGEEVNFKKIPLYRKRILSILVVVVIAIGIAAPVVLNVTSDATELN
                    *****:******************************************************

    COL             TSDQLYQKLVNPHLKGED
    N315            TSDQLYQKLVNPHLKGED
    NCTC8325        TSDQLYQKLVNPHLKGED
    Newman          TSDQLYQKLVNPHLKGED
    USA300_FPR3757  TSDQLYQKLVNPHLKGED
                    ******************