From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002498000
  • symbol?: mnhE2
  • description?: monovalent cation/H+ antiporter subunit E

      descriptions from strain specific annotations:

    • monovalent cation/H+ antiporter subunit E
    • putative monovalent cation/H+ antiporter subunit E
    • Na(+) H(+) antiporter subunit E
    • na+/H+ ion antiporter subunit
    • monovalent cation antiporter-3, MnhE_1
    • Putative antiporter subunit mnhE2
    • CPA3 family monovalent cation (K+ or Na+):proton (H+) antiporter-3, MnhE subunit
    • Na+/H+ antiporter
    • ShaE
  • strand?: +
  • coordinates?: 3010698..3011180
  • synteny block?: BlockID0017340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0597 (mnhE)
    USA300_FPR3757:
    04-02981:
    SA2981_0602
    08BA02176:
    C248_0709
    11819-97:
    MS7_0678
    71193:
    ST398NM01_0706
    ECT-R 2:
    ECTR2_578
    ED133:
    SAOV_0662
    ED98:
    SAAV_0590
    HO 5096 0412:
    SAEMRSA15_05530
    JH1:
    SaurJH1_0664
    JH9:
    SaurJH9_0649
    JKD6008:
    SAA6008_00644 (mnhE_1)
    JKD6159:
    SAA6159_00582 (mnhE_1)
    LGA251:
    SARLGA251_05610
    M013:
    M013TW_0615
    MRSA252:
    SAR0634
    MSHR1132:
    SAMSHR1132_05700
    MSSA476:
    SAS0593
    Mu3:
    SAHV_0623
    Mu50:
    SAV0626
    MW2:
    MW0589
    RF122:
    SAB0577
    ST398:
    SAPIG0706
    T0131:
    SAT0131_00694
    TCH60:
    HMPREF0772_12562 (mnhE2)
    TW20:
    SATW20_07020
    USA300_TCH1516:
    USA300HOU_0647 (mnhE1)
    VC40:
    SAVC_02770

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNQIVLNIIIAFLWVLFQDEDHFKFSTFFSGYLIGLIVIYILHRFFSDDFYVRKIWVAIK
    N315            MNQIVLNIIIAFLWVLFQDEDHFKFSTFFSGYLIGLIVIYILHRFFSDDFYVRKIWVAIK
    NCTC8325        MNQIVLNIIIAFLWVLFQDEDHFKFSTFFSGYLIGLIVIYILHRFFSDDFYVRKIWVAIK
    Newman          MNQIVLNIIIAFLWVLFQDEDHFKFSTFFSGYLIGLIVIYILHRFFSDDFYVRKIWVAIK
    USA300_FPR3757  MNQIVLNIIIAFLWVLFQDEDHFKFSTFFSGYLIGLIVIYILHRFFSDDFYVRKIWVAIK
                    ************************************************************

    COL             FLGVYLYQLITSSISTINYILFKTKDMNPGLLSYETRLTSDWSITFLTILIIITPGSTVI
    N315            FLGVYLYQLITSSISTINYILFKTKDMNPGLLSYETRLTSDWAITFLTILIIITPGSTVI
    NCTC8325        FLGVYLYQLITSSISTINYILFKTKDMNPGLLSYETRLTSDWSITFLTILIIITPGSTVI
    Newman          FLGVYLYQLITSSISTINYILFKTKDMNPGLLSYETRLTSDWSITFLTILIIITPGSTVI
    USA300_FPR3757  FLGVYLYQLITSSISTINYILFKTKDMNPGLLSYETRLTSDWSITFLTILIIITPGSTVI
                    ******************************************:*****************

    COL             RISQDSKKFFIHSIDVSEKEKDSLLRSIKHYEDLILEVSR
    N315            RISQDSKKFFIHSIDVSEKEKDSLLRSIKHYEDLILEVSR
    NCTC8325        RISQDSKKFFIHSIDVSEKEKDSLLRSIKHYEDLILEVSR
    Newman          RISQDSKKFFIHSIDVSEKEKDSLLRSIKHYEDLILEVSR
    USA300_FPR3757  RISQDSKKFFIHSIDVSEKEKDSLLRSIKHYEDLILEVSR
                    ****************************************