From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002502000
  • symbol?:
  • description?: sodium/hydrogen exchanger

      descriptions from strain specific annotations:

    • sodium/hydrogen exchanger
    • Na+/H+ antiporter
    • sodium/hydrogen exchanger family protein
    • Na+/H+ antiporter, putative
    • CPA1 family monovalent cation (K+ or Na+):proton (H+) antiporter-1
    • sodium-hydrogen exhange family protein
  • strand?: +
  • coordinates?: 3012236..3014278
  • synteny block?: BlockID0017380
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0605
    08BA02176:
    C248_0712
    11819-97:
    MS7_0681
    71193:
    ST398NM01_0709
    ECT-R 2:
    ECTR2_581
    ED133:
    SAOV_0665
    ED98:
    SAAV_0593
    HO 5096 0412:
    SAEMRSA15_05560
    JH1:
    SaurJH1_0667
    JH9:
    SaurJH9_0652
    JKD6008:
    SAA6008_00647
    JKD6159:
    SAA6159_00585
    LGA251:
    SARLGA251_05640
    M013:
    M013TW_0618
    MRSA252:
    SAR0637
    MSHR1132:
    SAMSHR1132_05730
    MSSA476:
    SAS0596
    Mu3:
    SAHV_0626
    Mu50:
    SAV0629
    MW2:
    MW0592
    RF122:
    SAB0580
    ST398:
    SAPIG0709
    T0131:
    SAT0131_00698 (gatB)
    TCH60:
    HMPREF0772_12559
    TW20:
    SATW20_07050
    USA300_TCH1516:
    USA300HOU_0650
    VC40:
    SAVC_02785

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEIFETILIFIAVVILSSFVHTFIPKVPLAFIQIFLGMLLFITPIPVQFNFDSELFMVTM
    N315            MEIFETILIFIAVVILSSFVHTFIPKVPLAFIQIFLGMLLFITPIPVQFNFDSELFMVTM
    NCTC8325        -------------MILSSFVHTFIPKVPLAFIQIFLGMLLFITPIPVQFNFDSELFMVTM
    Newman          MEIFETILIFIAVVILSSFVHTFIPKVPLAFIQIFLGMLLFITPIPVQFNFDSELFMVTM
    USA300_FPR3757  -------------MILSSFVHTFIPKVPLAFIQIFLGMLLFITPIPVQFNFDSELFMVTM
                                 :**********************************************

    COL             IAPLLFVEGVNVSRVHLRKYIKPVMMMALGLVITTVIGVGLFIHWIWPDLPIGAAFAIAA
    N315            IAPLLFVEGVNVSRVHLRKYIKPVMMMALGLVITTVIGVGLFIHWIWPDLPIGAAFAIAA
    NCTC8325        IAPLLFVEGVNVSRVHLRKYIKPVMMMALGLVITTVIGVGLFIHWIWPDLPIGAAFAIAA
    Newman          IAPLLFVEGVNVSRVHLRKYIKPVMMMALGLVITTVIGVGLFIHWIWPDLPIGAAFAIAA
    USA300_FPR3757  IAPLLFVEGVNVSRVHLRKYIKPVMMMALGLVITTVIGVGLFIHWIWPDLPIGAAFAIAA
                    ************************************************************

    COL             ILCPTDAVAVQAITKGKVLPKGAMTILEGESLLNDAAGIISFKIAVGVLVTGAFSLVDAV
    N315            ILCPTDAVAVQAITKGKVLPKGAMTILEGESLLNDAAGIISFKIAVGVLVTGAFSLVDAV
    NCTC8325        ILCPTDAVAVQAITKGKVLPKGAMTILEGESLLNDAAGIISFKIAVGVLVTGAFSLVDAV
    Newman          ILCPTDAVAVQAITKGKVLPKGAMTILEGESLLNDAAGIISFKIAVGVLVTGAFSLVDAV
    USA300_FPR3757  ILCPTDAVAVQAITKGKVLPKGAMTILEGESLLNDAAGIISFKIAVGVLVTGAFSLVDAV
                    ************************************************************

    COL             QLFLIASIGGAVVGLLIGMALVRFRLTLMRRGYENINMFTIIQLLTPFVTYLIAELFHAS
    N315            QLFLIASIGGAVVGLLIGMALVRFRLTLMRRGYENINMFTIIQLLTPFVTYLIAELFHAS
    NCTC8325        QLFLIASIGGAVVGLLIGMALVRFRLTLMRRGYENINMFTIIQLLTPFVTYLIAELFHAS
    Newman          QLFLIASIGGAVVGLLIGMALVRFRLTLMRRGYENINMFTIIQLLTPFVTYLIAELFHAS
    USA300_FPR3757  QLFLIASIGGAVVGLLIGMALVRFRLTLMRRGYENINMFTIIQLLTPFVTYLIAELFHAS
                    ************************************************************

    COL             GIIAAVVAGLVHGFERDRIMQVRTQLQMSYNHTWNILGYVLNGFVFSILGFLVPEVIIKI
    N315            GIIAAVVAGLVHGFERDRIMQVRTQLQMSYNHTWNILGYVLNGFVFSILGFLVPEVIIKI
    NCTC8325        GIIAAVVAGLVHGFERDRIMQVRTQLQMSYNHTWNILGYVLNGFVFSILGFLVPEVIIKI
    Newman          GIIAAVVAGLVHGFERDRIMQVRTQLQMSYNHTWNILGYVLNGFVFSILGFLVPEVIIKI
    USA300_FPR3757  GIIAAVVAGLVHGFERDRIMQVRTQLQMSYNHTWNILGYVLNGFVFSILGFLVPEVIIKI
                    ************************************************************

    COL             IKTEPHNLIFLIGITIVVALAVYLFRFVWVYVLYPYFYLAISPFQKMMTKNDDDNPTTEK
    N315            IKTEPHNLIFLIGITIVVALAVYLFRFVWVYVLYPYFYLAISPFQKMMTKNDDDNPTTEK
    NCTC8325        IKTEPHNLIFLIGITIVVALAVYLFRFVWVYVLYPYFYLAISPFQKMMTKNDDDNPTTEK
    Newman          IKTEPHNLIFLIGITIVVALAVYLFRFVWVYVLYPYFYLAISPFQKMMTKNDDDNPTTEK
    USA300_FPR3757  IKTEPHNLIFLIGITIVVALAVYLFRFVWVYVLYPYFYLAISPFQKMMTKNDDDNPTTEK
                    ************************************************************

    COL             PPKRSLYALIMTLCGVHGTISLAIALTLPYFLAGHHAFTYRNDLLFIASGMVIISLVVAQ
    N315            PPKRSLYALIMTLCGVHGTISLAIALTLPYFLAGHHAFTYRNDLLFIASGMVIISLVVAQ
    NCTC8325        PPKRSLYALIMTLCGVHGTISLAIALTLPYFLAGHHAFTYRNDLLFIASGMVIISLVVAQ
    Newman          PPKRSLYALIMTLCGVHGTISLAIALTLPYFLAGHHAFTYRNDLLFIASGMVIISLVVAQ
    USA300_FPR3757  PPKRSLYALIMTLCGVHGTISLAIALTLPYFLAGHHAFTYRNDLLFIASGMVIISLVVAQ
                    ************************************************************

    COL             VLLPLLTKPAPKTVIGNMSFKVARIYILEQVIDYLNQKSTFETSFKYGNVIKEYHDKLAF
    N315            VLLPLLTKPAPKTVIGNMSFKVARIYILEQVIDYLNQKSTFETSFKYGNVIKEYHDKLAF
    NCTC8325        VLLPLLTKPAPKTVIGNMSFKVARIYILEQVIDYLNQKSTFETSFKYGNVIKEYHDKLAF
    Newman          VLLPLLTKPAPKTVIGNMSFKVARIYILEQVIDYLNQKSTFETSFKYGNVIKEYHDKLAF
    USA300_FPR3757  VLLPLLTKPAPKTVIGNMSFKVARIYILEQVIDYLNQKSTFETSFKYGNVIKEYHDKLAF
                    ************************************************************

    COL             LKTVEKDDENSKELERLQKIAFNVETKTLESLVDEGQITNSVLENYMRYAERTQVYRQAS
    N315            LKTVEKDDENSKELERLQKIAFNVETKTLESLVDEGQITNSVLENYMRYAERTQVYRQAS
    NCTC8325        LKTVEKDDENSKELERLQKIAFNVETKTLESLVDEGQITNSVLENYMRYAERTQVYRQAS
    Newman          LKTVEKDDENSKELERLQKIAFNVETKTLESLVDEGQITNSVLENYMRYAERTQVYRQAS
    USA300_FPR3757  LKTVEKDDENSKELERLQKIAFNVETKTLESLVDEGQITNSVLENYMRYAERTQVYRQAS
                    ************************************************************

    COL             LIRRMIVLLRGALLKRRVQTRVNSASSLSVTDNLMELNKINKLVHYNVVSRLSKETTKDN
    N315            LIRRMIVLLRGALLKRRVQTRVNSASSLSVTDNLMELNKINKLVHYNVVSRLSKETTKDN
    NCTC8325        LIRRMIVLLRGALLKRRVQTRVNSASSLSVTDNLMELNKINKLVHYNVVSRLSKETTKDN
    Newman          LIRRMIVLLRGALLKRRVQTRVNSASSLSVTDNLMELNKINKLVHYNVVSRLSKETTKDN
    USA300_FPR3757  LIRRMIVLLRGALLKRRVQTRVNSASSLSVTDNLMELNKINKLVHYNVVSRLSKETTKDN
                    ************************************************************

    COL             TLEVGMVCDGYLMRIENLTPSNFFNSASEDTITKIKLNALREQRRILRELIDTDEVSEGT
    N315            TLEIGMVCDGYLMRIENLTPSNFFNSASEDTITKIKLNALREQRRILRELIDTDEVSEGT
    NCTC8325        TLEVGMVCDGYLMRIENLTPSNFFNSASEDTITKIKLNALREQRRILRELIDTDEVSEGT
    Newman          TLEVGMVCDGYLMRIENLTPSNFFNSASEDTITKIKLNALREQRRILRELIDTDEVSEGT
    USA300_FPR3757  TLEVGMVCDGYLMRIENLTPSNFFNSASEDTITKIKLNALREQRRILRELIDTDEVSEGT
                    ***:********************************************************

    COL             ALKLREAINYDEMVIVDSMT
    N315            ALKLREAINYDEMVIVDSMT
    NCTC8325        ALKLREAINYDEMVIVDSMT
    Newman          ALKLREAINYDEMVIVDSMT
    USA300_FPR3757  ALKLREAINYDEMVIVDSMT
                    ********************