From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002510000
  • symbol?: mntR
  • description?: DtxR family transcriptional regulator

      descriptions from strain specific annotations:

    • DtxR family transcriptional regulator
    • iron-dependent repressor
    • iron dependent repressor, N-terminal DNA binding domain protein
    • metal-dependent transcriptional regulator
    • metalloregulator
    • Mn-dependent transcriptional regulator MntR
    • putative metalloregulator
  • strand?: +
  • coordinates?: 3023316..3023960
  • synteny block?: BlockID0017460
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0691 (sirR)
    N315:
    NCTC8325:
    Newman:
    NWMN_0604 (feoA)
    USA300_FPR3757:
    04-02981:
    SA2981_0610 (mntR)
    08BA02176:
    C248_0716 (sirR)
    11819-97:
    MS7_0685
    71193:
    ST398NM01_0713
    ECT-R 2:
    ECTR2_586
    ED133:
    SAOV_0669 (sirR)
    ED98:
    SAAV_0597 (sirR)
    HO 5096 0412:
    SAEMRSA15_05600 (sirR)
    JH1:
    SaurJH1_0672
    JH9:
    SaurJH9_0657
    JKD6008:
    SAA6008_00651
    JKD6159:
    SAA6159_00589
    LGA251:
    SARLGA251_05680 (sirR)
    M013:
    M013TW_0622
    MRSA252:
    SAR0644 (sirR)
    MSHR1132:
    SAMSHR1132_05800
    MSSA476:
    SAS0600
    Mu3:
    SAHV_0631
    Mu50:
    SAV0634
    MW2:
    MW0596
    RF122:
    SAB0584 (mntR)
    ST398:
    SAPIG0713
    T0131:
    SAT0131_00703 (gatA)
    TCH60:
    HMPREF0772_12553 (sirR)
    TW20:
    SATW20_07090 (sirR)
    USA300_TCH1516:
    USA300HOU_0654
    VC40:
    SAVC_02805

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLTEEKEDYLKAILTNNGDKNFVTNKILSQFLNIKPPSVSEMVGRLEKAGYVETKPYKGV
    N315            MLTEEKEDYLKAILTNNGDKNFVTNKILSQFLNIKPPSVSEMVGRLEKAGYVETKPYKGV
    NCTC8325        MLTEEKEDYLKAILTNNGDKNFVTNKILSQFLNIKPPSVSEMVGRLEKAGYVETKPYKGV
    Newman          MLTEEKEDYLKAILTNNGDKNFVTNKILSQFLNIKPPSVSEMVGRLEKAGYVETKPYKGV
    USA300_FPR3757  MLTEEKEDYLKAILTNNGDKNFVTNKILSQFLNIKPPSVSEMVGRLEKAGYVETKPYKGV
                    ************************************************************

    COL             RLTEDGLTHTLDIIKRHRLLELFLIEILKYNWEEVHQEAEILEHRISDLFVERLDSLLNF
    N315            RLTEDGLTHTLDIIKRHRLLELFLIEILKYNWEEVHQEAEILEHRISDLFVERLDSLLNF
    NCTC8325        RLTEDGLTHTLDIIKRHRLLELFLIEILKYNWEEVHQEAEILEHRISDLFVERLDSLLNF
    Newman          RLTEDGLTHTLDIIKRHRLLELFLIEILKYNWEEVHQEAEILEHRISDLFVERLDSLLNF
    USA300_FPR3757  RLTEDGLTHTLDIIKRHRLLELFLIEILKYNWEEVHQEAEILEHRISDLFVERLDSLLNF
                    ************************************************************

    COL             PETCPHGGVIPRNNEYKEKYITTILNYEPGDIVTIKRVRDKTDLLIYLSSKDISIGNEVE
    N315            PETCPHGGVIPRNNEYKEKYITTILNYEPGDIVTIKRVRDKTDLLIYLSSKDISIGNEVE
    NCTC8325        PETCPHGGVIPRNNEYKEKYITTILNYEPGDIVTIKRVRDKTDLLIYLSSKDISIGNEVE
    Newman          PETCPHGGVIPRNNEYKEKYITTILNYEPGDIVTIKRVRDKTDLLIYLSSKDISIGNEVE
    USA300_FPR3757  PETCPHGGVIPRNNEYKEKYITTILNYEPGDIVTIKRVRDKTDLLIYLSSKDISIGNEVE
                    ************************************************************

    COL             IVSKDEMNKVIIIKRNDNVIIVSYENAMNMFAEK
    N315            IVSKDEMNKVIIIKRNDNVIIVSYENAMNMFAEK
    NCTC8325        IVSKDEMNKVIIIKRNDNVIIVSYENAMNMFAEK
    Newman          IVSKDEMNKVIIIKRNDNVIIVSYENAMNMFAEK
    USA300_FPR3757  IVSKDEMNKVIIIKRNDNVIIVSYENAMNMFAEK
                    **********************************