From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002511000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • membrane spanning protein
  • strand?: -
  • coordinates?: 3024040..3024792
  • synteny block?: BlockID0017470
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0611
    08BA02176:
    C248_0717
    11819-97:
    MS7_0686
    71193:
    ST398NM01_0714
    ECT-R 2:
    ECTR2_587
    ED133:
    SAOV_0670c
    ED98:
    SAAV_0598
    HO 5096 0412:
    SAEMRSA15_05610
    JH1:
    SaurJH1_0673
    JH9:
    SaurJH9_0658
    JKD6008:
    SAA6008_00652
    JKD6159:
    SAA6159_00590
    LGA251:
    SARLGA251_05690
    M013:
    M013TW_0623
    MRSA252:
    SAR0645
    MSHR1132:
    SAMSHR1132_05810
    MSSA476:
    SAS0601
    Mu3:
    SAHV_0632
    Mu50:
    SAV0635
    MW2:
    MW0597
    RF122:
    SAB0585c
    ST398:
    SAPIG0714
    T0131:
    SAT0131_00704
    TCH60:
    HMPREF0772_12552
    TW20:
    SATW20_07100
    USA300_TCH1516:
    USA300HOU_0655
    VC40:
    SAVC_02810

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFG
    N315            ----MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFG
    NCTC8325        ----MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFG
    Newman          MRLTMNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFG
    USA300_FPR3757  ----MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFG
                        ********************************************************

    COL             HVLFNKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYFMPPIMLLI
    N315            HVLFNKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYLMPPIMLLI
    NCTC8325        HVLFNKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYFMPPIMLLI
    Newman          HVLFNKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYFMPPIMLLI
    USA300_FPR3757  HVLFNKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYFMPPIMLLI
                    ***************************************************:********

    COL             GLASSHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLL
    N315            GLASSHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLL
    NCTC8325        GLASSHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLL
    Newman          GLASSHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLL
    USA300_FPR3757  GLASSHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLL
                    ************************************************************

    COL             VTMSYQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNL
    N315            VTMSYQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNL
    NCTC8325        VTMSYQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNL
    Newman          VTMSYQYILGII-----------------RRS-------------------STI------
    USA300_FPR3757  VTMSYQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNL
                    **********::                 * *                   ***      

    COL             YAVNILLKYTHLIN
    N315            YAVNILLKYTHLIN
    NCTC8325        YAVNILLKYTHLIN
    Newman          --------------
    USA300_FPR3757  YAVNILLKYTHLIN