From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002519000
  • symbol?: pbp4
  • description?: penicillin-binding protein 4

      descriptions from strain specific annotations:

    • penicillin-binding protein 4
    • D-alanyl-D-alanine carboxypeptidase
    • Serine-type D-Ala-D-Ala carboxypeptidase
    • D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
    • D-alanyl-D-alanine carboxypeptidase / Penicillin binding protein PBP4
  • strand?: -
  • coordinates?: 3030697..3031992
  • synteny block?: BlockID0017550
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0699 (pbp4)
    N315:
    SA0598 (pbp4)
    NCTC8325:
    Newman:
    NWMN_0612 (pbp4)
    USA300_FPR3757:
    04-02981:
    SA2981_0618
    08BA02176:
    C248_0724 (pbp4)
    11819-97:
    MS7_0693 (pbp4)
    71193:
    ST398NM01_0721
    ECT-R 2:
    ECTR2_594
    ED133:
    SAOV_0677c (pbp4)
    ED98:
    SAAV_0605 (pbp4)
    HO 5096 0412:
    SAEMRSA15_05680 (pbp4)
    JH1:
    SaurJH1_0680
    JH9:
    SaurJH9_0665
    JKD6008:
    SAA6008_00659 (pbp4)
    JKD6159:
    SAA6159_00597 (pbp4)
    LGA251:
    SARLGA251_05760 (pbp4)
    M013:
    M013TW_0630
    MRSA252:
    SAR0652 (pbp4)
    MSHR1132:
    SAMSHR1132_05880
    MSSA476:
    SAS0608
    Mu3:
    SAHV_0639 (pbp4)
    Mu50:
    SAV0642 (pbp4)
    MW2:
    MW0604 (pbp4)
    RF122:
    SAB0592c (pbp4)
    ST398:
    SAPIG0721
    T0131:
    SAT0131_00711
    TCH60:
    HMPREF0772_12545 (dacB)
    TW20:
    SATW20_07170 (pbp4)
    USA300_TCH1516:
    USA300HOU_0662 (pbp4)
    VC40:
    SAVC_02845

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNLISIIIILCLTLSIMTPYAQATNSDVTPVQAANQYGYAGLSAAYEPTSAVNVSQTGQ
    N315            MKNLISIIIILCLTLSIMTPYAQATNSDVTPVQAANQYGYAGLSAAYEPTSAVNVSQTGQ
    NCTC8325        MKNLISIIIILCLTLSIMTPYAQATNSDVTPVQAANQYGYAGLSAAYEPTSAVNVSQTGQ
    Newman          MKNLISIIIILCLTLSIMTPYAQATNSDVTPVQAANQYGYAGLSAAYEPTSAVNVSQTGQ
    USA300_FPR3757  MKNLISIIIILCLTLSIMTPYAQATNSDVTPVQAANQYGYAGLSAAYEPTSAVNVSQTGQ
                    ************************************************************

    COL             LLYQYNIDTKWNPASMTKLMTMYLTLEAVNKGQLSLDDTVTMTNKEYIMSTLPELSNTKL
    N315            LLYQYNIDTKWNPASMTKLMTMYLTLEAVNKGQLSLDDTVTMTNKEYIMSTLPELSNTKL
    NCTC8325        LLYQYNIDTKWNPASMTKLMTMYLTLEAVNKGQLSLDDTVTMTNKEYIMSTLPELSNTKL
    Newman          LLYQYNIDTKWNPASMTKLMTMYLTLEAVNKGQLSLDDTVTMTNKEYIMSTLPELSNTKL
    USA300_FPR3757  LLYQYNIDTKWNPASMTKLMTMYLTLEAVNKGQLSLDDTVTMTNKEYIMSTLPELSNTKL
                    ************************************************************

    COL             YPGQVWTIADLLQITVSNSSNAAALILAKKVSKNTSDFVDLMNNKAKAIGMKNTHFVNPT
    N315            YPGQVWTIADLLQITVSNSSNAAALILAKKVSKNTSDFVDLMNNKAKAIGMKNTHFVNPT
    NCTC8325        YPGQVWTIADLLQITVSNSSNAAALILAKKVSKNTSDFVDLMNNKAKAIGMKNTHFVNPT
    Newman          YPGQVWTIADLLQITVSNSSNAAALILAKKVSKNTSDFVDLMNNKAKAIGMKNTHFVNPT
    USA300_FPR3757  YPGQVWTIADLLQITVSNSSNAAALILAKKVSKNTSDFVDLMNNKAKAIGMKNTHFVNPT
                    ************************************************************

    COL             GAENSRLRTFAPTKYKDQERTVTTARDYAILDLHVIKETPKILDFTKQLAPTTHAVTYYT
    N315            GAENSRLRSFAPTKYKDQERTVTTARDYAILDLHVIKETPKILDFTKQLAPTTHAVTYYT
    NCTC8325        GAENSRLRTFAPTKYKDQERTVTTARDYAILDLHVIKETPKILDFTKQLAPTTHAVTYYT
    Newman          GAENSRLRTFAPTKYKDQERTVTTARDYAILDLHVIKETPKILDFTKQLAPTTHAVTYYT
    USA300_FPR3757  GAENSRLRTFAPTKYKDQERTVTTARDYAILDLHVIKETPKILDFTKQLAPTTHAVTYYT
                    ********:***************************************************

    COL             FNFSLEGAKMSLPGTDGLKTGSSDTANYNHTITTKRGKFRINQVIMGAGDYKNLGGEKQR
    N315            FNFSLEGAKMSLPGTDGLKTGSSDTANYNHTITTKRGKFRINQVIMGAGDYKNLGGEKQR
    NCTC8325        FNFSLEGAKMSLPGTDGLKTGSSDTANYNHTITTKRGKFRINQVIMGAGDYKNLGGEKQR
    Newman          FNFSLEGAKMSLPGTDGLKTGSSDTANYNHTITTKRGKFRINQVIMGAGDYKNLGGEKQR
    USA300_FPR3757  FNFSLEGAKMSLPGTDGLKTGSSDTANYNHTITTKRGKFRINQVIMGAGDYKNLGGEKQR
                    ************************************************************

    COL             NMMGNALMERSFDQYKYVKILSKGEQRINGKKYYVENDLYDVLPSDFSKKDYKLVVEDGK
    N315            NMMGNALMERSFDQYKYVKILSKGEQRINGKKYYVENDLYDVLPSDFSKKDYKLVVEDGK
    NCTC8325        NMMGNALMERSFDQYKYVKILSKGEQRINGKKYYVENDLYDVLPSDFSKKDYKLVVEDGK
    Newman          NMMGNALMERSFDQYKYVKILSKGEQRINGKKYYVENDLYDVLPSDFSKKDYKLVVEDGK
    USA300_FPR3757  NMMGNALMERSFDQYKYVKILSKGEQRINGKKYYVENDLYDVLPSDFSKKDYKLVVEDGK
                    ************************************************************

    COL             VHADYPREFINKDYGPPTVEVHQPIIQKANTVAKSMWEEHPLFTIIGGTCLVAGLALIVH
    N315            VHADYPREFINKDYGPPTVEVHQPIIQKANTVAKSMWEEHPLFTIIGGACLVAGLALIVH
    NCTC8325        VHADYPREFINKDYGPPTVEVHQPIIQKANTVAKSMWEEHPLFTIIGGTCLVAGLALIVH
    Newman          VHADYPREFINKDYGPPTVEVHQPIIQKANTVAKSMWEEHPLFTIIGGTCLVAGLALIVH
    USA300_FPR3757  VHADYPREFINKDYGPPTVEVHQPIIQKANTVAKSMWEEHPLFTIIGGTCLVAGLALIVH
                    ************************************************:***********

    COL             MIINRLFRKRK
    N315            MIINRLFRKRK
    NCTC8325        MIINRLFRKRK
    Newman          MIINRLFRKRK
    USA300_FPR3757  MIINRLFRKRK
                    ***********