From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002526000
  • symbol?: fhuB
  • description?: iron ABC transporter permease

      descriptions from strain specific annotations:

    • iron ABC transporter permease
    • ferrichrome transport permease FhuB
    • iron compound ABC transporter permease
    • ferrichrome ABC transporter permease
    • Ferrichrome transport system permease protein fhuB
    • cell wall anchor domain-containing protein
    • Fe3+-siderophore ABC transporter permease
    • fecCD transport family protein
    • iron (Fe3+) ABC superfamily ATP binding cassette transporter, membrane protein
    • iron (Fe3+) ABC transporter membrane protein
    • iron compound ABC transporter, permease protein
    • LPXTG-motif cell wall anchor domain-containing protein
  • strand?: +
  • coordinates?: 3038715..3039740
  • synteny block?: BlockID0017620
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0603 (fhuB)
    NCTC8325:
    Newman:
    NWMN_0617 (fhuB)
    USA300_FPR3757:
    04-02981:
    SA2981_0624 (fhuB)
    08BA02176:
    C248_0731 (fhuB)
    11819-97:
    MS7_0698
    71193:
    ST398NM01_0726
    ECT-R 2:
    ECTR2_599
    ED133:
    SAOV_0682
    ED98:
    SAAV_0610
    HO 5096 0412:
    SAEMRSA15_05740 (fhuB)
    JH1:
    SaurJH1_0686
    JH9:
    SaurJH9_0671
    JKD6008:
    SAA6008_00664 (fhuB)
    JKD6159:
    SAA6159_00602 (fhuB)
    LGA251:
    SARLGA251_05810 (fhuB)
    M013:
    M013TW_0635
    MRSA252:
    SAR0658 (fhuB)
    MSHR1132:
    SAMSHR1132_05930
    MSSA476:
    SAS0613
    Mu3:
    SAHV_0645 (fhuB)
    Mu50:
    SAV0648 (fhuB)
    MW2:
    MW0610 (fhuB)
    RF122:
    SAB0597 (fhuB)
    ST398:
    SAPIG0726
    T0131:
    SAT0131_00718
    TCH60:
    HMPREF0772_12540 (fhuB)
    TW20:
    SATW20_07230 (fhuB)
    USA300_TCH1516:
    USA300HOU_0669 (fhuB)
    VC40:
    SAVC_02870

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNRENPTPLKFLSYIIGLSMILLITLFISTLIGDAKIQASTIIEAIFNYNPSNQQQNII
    N315            MTNRENPTPLKFLSYIIGLSMILLITLFISTLIGDAKIQASTIIEAIFNYNPSNQQQNII
    NCTC8325        MTNRENPTPLKFLSYIIGLSMILLITLFISTLIGDAKIQASTIIEAIFNYNPSNQQQNII
    Newman          ---------MKFLSYIIGLSMILLITLFISTLIGDAKIQASTIIEAIFNYNPSNQQQNII
    USA300_FPR3757  MTNRENPTPLKFLSYIIGLSMILLITLFISTLIGDAKIQASTIIEAIFNYNPSNQQQNII
                             :**************************************************

    COL             NEIRIPRNIAAVIVGMALAVSGAIIQGVTRNGLADPALIGLNSGASFALALTYAVLPNTS
    N315            NEIRIPRNIAAVIVGMALAVSGAIIQGVTRNGLADPALIGLNSGASFALALTYAVLPNTS
    NCTC8325        NEIRIPRNIAAVIVGMALAVSGAIIQGVTRNGLADPALIGLNSGASFALALTYAVLPNTS
    Newman          NEIRIPRNIAAVIVGMALAVSGAIIQGVTRNGLADPALIGLNSGASFALALTYAVLPNTS
    USA300_FPR3757  NEIRIPRNIAAVIVGMALAVSGAIIQGVTRNGLADPALIGLNSGASFALALTYAVLPNTS
                    ************************************************************

    COL             FLILMFAGFLGAILGGAIVLMIGRSRRDGFNPMRIILAGAAVSAMLTALSQGIALAFRLN
    N315            FLILMFAGFLGAILGGAIVLMIGRSRRDGFNPMRIILAGAAVSAMLTALSQGIALAFRLN
    NCTC8325        FLILMFAGFLGAILGGAIVLMIGRSRRDGFNPMRIILAGAAVSAMLTALSQGIALAFRLN
    Newman          FLILMFAGFLGAILGGAIVLMIGRSRRDGFNPMRIILAGAAVSAMLTALSQGIALAFRLN
    USA300_FPR3757  FLILMFAGFLGAILGGAIVLMIGRSRRDGFNPMRIILAGAAVSAMLTALSQGIALAFRLN
                    ************************************************************

    COL             QTVTFWTAGGVSGTTWSHLKWAIPLIGIALFIILTISKQLTILNLGESLAKGLGQNVTMI
    N315            QTVTFWTAGGVSGTTWSHLKWAIPLIGIALFIILTISKQLTILNLGESLAKGLGQNVTMI
    NCTC8325        QTVTFWTAGGVSGTTWSHLKWAIPLIGIALFIILTISKQLTILNLGESLAKGLGQNVTMI
    Newman          QTVTFWTAGGVSGTTWSHLKWAIPLIGIALFIILTISKQLTILNLGESLAKGLGQNVTMI
    USA300_FPR3757  QTVTFWTAGGVSGTTWSHLKWAIPLIGIALFIILTISKQLTILNLGESLAKGLGQNVTMI
                    ************************************************************

    COL             RGICLIIAMILAGIAVAIAGQVAFVGLMVPHIARFLIGTDYAKILPLTALLGGILVLVAD
    N315            RGICLIIAMILAGIAVAIAGQVAFVGLMVPHIARFLIGTDYAKILPLTALLGGILVLVAD
    NCTC8325        RGICLIIAMILAGIAVAIAGQVAFVGLMVPHIARFLIGTDYAKILPLTALLGGILVLVAD
    Newman          RGICLIIAMILAGIAVAIAGQVAFVGLMVPHIARFLIGTDYAKILPLTALLGGILVLVAD
    USA300_FPR3757  RGICLIIAMILAGIAVAIAGQVAFVGLMVPHIARFLIGTDYAKILPLTALLGGILVLVAD
                    ************************************************************

    COL             VIARYLGEAPVGAIISFIGVPYFLYLVKKGGRSI
    N315            VIARYLGEAPVGAIISFIGVPYFLYLVKKGGRSI
    NCTC8325        VIARYLGEAPVGAIISFIGVPYFLYLVKKGGRSI
    Newman          VIARYLGEAPVGAIISFIGVPYFLYLVKKGGRSI
    USA300_FPR3757  VIARYLGEAPVGAIISFIGVPYFLYLVKKGGRSI
                    **********************************