From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002533000
  • symbol?:
  • description?: alpha/beta hydrolase

      descriptions from strain specific annotations:

    • alpha/beta hydrolase
    • lipase/esterase
    • lipase/esterase LipA
    • putative lipase/esterase
    • Lipase LipA
    • alpha/beta hydrolase domain-containing protein
    • alpha/beta hydrolase fold family protein
    • peptidase
    • putative esterase
  • strand?: +
  • coordinates?: 3045452..3046495
  • synteny block?: BlockID0017690
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0624 (lipA)
    USA300_FPR3757:
    04-02981:
    SA2981_0631 (lipA)
    08BA02176:
    C248_0738
    11819-97:
    MS7_0705
    71193:
    ST398NM01_0733
    ECT-R 2:
    ECTR2_606
    ED133:
    SAOV_0689
    ED98:
    SAAV_0617
    HO 5096 0412:
    SAEMRSA15_05810
    JH1:
    SaurJH1_0693
    JH9:
    SaurJH9_0678
    JKD6008:
    SAA6008_00671
    JKD6159:
    SAA6159_00609
    LGA251:
    SARLGA251_05880
    M013:
    M013TW_0642
    MRSA252:
    SAR0665
    MSHR1132:
    SAMSHR1132_06010
    MSSA476:
    SAS0620
    Mu3:
    SAHV_0652
    Mu50:
    SAV0655
    MW2:
    MW0617
    RF122:
    SAB0604
    ST398:
    SAPIG0733
    T0131:
    SAT0131_00725
    TCH60:
    HMPREF0772_12533
    TW20:
    SATW20_07300
    USA300_TCH1516:
    USA300HOU_0676
    VC40:
    SAVC_02905

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKDNKWTMITALFITVISVLLAFHLKQHYDQITNENHANKDKINIKNKNVRIYQNLTYN
    N315            MNKDNKWTMITALFITVISVLLAFHLKQHYDQITNENHANKDKINIKNKNVRIYQNLTYN
    NCTC8325        MNKDNKWTMITALFITVISVLLAFHLKQHYDQITNENHANKDKINIKNKNVRIYQNLTYN
    Newman          MNKDNKWTMITALFITVISVLLAFHLKQHYDQITNENHANKDKINIKNKNVRIYQNLTYN
    USA300_FPR3757  MNKDNKWTMITALFITVISVLLAFHLKQHYDQITNENHANKDKINIKNKNVRIYQNLTYN
                    ************************************************************

    COL             RVFPNSKLDIITPVDMSSNAKLPVIFWMHGGGYIAGDKQYKNPLLAKIAEQGYIVVNVNY
    N315            RVFPNSKLDIITPVDMSSNAKLPVIFWMHGGGYIAGDKQYKNPLLAKIAEQGYIVVNVNY
    NCTC8325        RVFPNSKLDIITPVDMSSNAKLPVIFWMHGGGYIAGDKQYKNPLLAKIAEQGYIVVNVNY
    Newman          RVFPNSKLDIITPVDMSSNAKLPVIFWMHGGGYIAGDKQYKNPLLAKIAEQGYIVVNVNY
    USA300_FPR3757  RVFPNSKLDIITPVDMSSNAKLPVIFWMHGGGYIAGDKQYKNPLLAKIAEQGYIVVNVNY
                    ************************************************************

    COL             ALAPQYKYPTPLIQMNQATQFIKENKMNLPIDFNQVIIGGDSAGAQLASQFTAIQTNDRL
    N315            ALAPQYKYPTPLIQMNQATQFIKENKMNLPIDFNQVIIGGDSAGAQLASQFTAIQTNDRL
    NCTC8325        ALAPQYKYPTPLIQMNQATQFIKENKMNLPIDFNQVIIGGDSAGAQLASQFTAIQTNDRL
    Newman          ALAPQYKYPTPLIQMNQATQFIKENKMNLPIDFNQVIIGGDSAGAQLASQFTAIQTNDRL
    USA300_FPR3757  ALAPQYKYPTPLIQMNQATQFIKENKMNLPIDFNQVIIGGDSAGAQLASQFTAIQTNDRL
                    ************************************************************

    COL             REAMKFDQSFKPSQIKGAILFGGFYNMQTVRETEFPRIQLFMKSYTGEEDWEKSFKNISQ
    N315            REAMKFDQSFKPSQIKGAILFGGFYNMQTVRETEFPRIQLFMKSYTGEEDWEKSFKNISQ
    NCTC8325        REAMKFDQSFKPSQIKGAILFGGFYNMQTVRETEFPRIQLFMKSYTGEEDWEKSFKNISQ
    Newman          REAMKFDQSFKPSQIKGAILFGGFYNMQTVRETEFPRIQLFMKSYTGEEDWEKSFKNISQ
    USA300_FPR3757  REAMKFDQSFKPSQIKGAILFGGFYNMQTVRETEFPRIQLFMKSYTGEEDWEKSFKNISQ
                    ************************************************************

    COL             MSTVKQSTKNYPPTFLSVGDSDPFESQNIEFSKKLQELNVPVDTLFYDGTHHLHHQYQFH
    N315            MSTVKQSTKNYPPTFLSVGDSDPFESQNIEFSKKLQELNVPVDTLFYDGTHHLHHQYQFH
    NCTC8325        MSTVKQSTKNYPPTFLSVGDSDPFESQNIEFSKKLQELNVPVDTLFYDGTHHLHHQYQFH
    Newman          MSTVKQSTKNYPPTFLSVGDSDPFESQNIEFSKKLQELNVPVDTLFYDGTHHLHHQYQFH
    USA300_FPR3757  MSTVKQSTKNYPPTFLSVGDSDPFESQNIEFSKKLQELNVPVDTLFYDGTHHLHHQYQFH
                    ************************************************************

    COL             LNKPESIDNIKKVLLFLSRNTSSSGIQTEEKPQIENPSNELPLNPLN
    N315            LNKPESIDNIKKVLLFLSRNTSSSGIQTEEKPQMENPSNELPLNPLN
    NCTC8325        LNKPESIDNIKKVLLFLSRNTSSSGIQTEEKPQIENPSNELPLNPLN
    Newman          LNKPESIDNIKKVLLFLSRNTSSSGIQTEEKPQIENPSNELPLNPLN
    USA300_FPR3757  LNKPESIDNIKKVLLFLSRNTSSSGIQTEEKPQIENPSNELPLNPLN
                    *********************************:*************