From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002539000
  • symbol?: graS
  • description?: sensor histidine kinase

      descriptions from strain specific annotations:

    • sensor histidine kinase
    • sensor histidine kinase graS
    • ATPase
    • his Kinase A (phosphoacceptor) domain protein
    • integral membrane sensor signal transduction histidine kinase
    • putative sensor histidine kinase protein
    • Response regulator protein graS
    • sensor histidine kinase, GraS
    • sensor histidine kinase protein
    • sensor protein BceS
    • two-component sensor histidine kinase
    • Two-component sensor histidine kinase BceS
  • strand?: +
  • coordinates?: 3049812..3050852
  • synteny block?: BlockID0017750
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0636 (bceS)
    08BA02176:
    C248_0744
    11819-97:
    MS7_0710 (graS)
    71193:
    ST398NM01_0738
    ECT-R 2:
    ECTR2_611
    ED133:
    SAOV_0694
    ED98:
    SAAV_0622
    HO 5096 0412:
    SAEMRSA15_05860
    JH1:
    SaurJH1_0698
    JH9:
    SaurJH9_0683
    JKD6008:
    SAA6008_00676 (graS)
    JKD6159:
    SAA6159_00614 (graS)
    LGA251:
    SARLGA251_05930 (graS)
    M013:
    M013TW_0647
    MRSA252:
    SAR0670
    MSHR1132:
    SAMSHR1132_06060
    MSSA476:
    SAS0625
    Mu3:
    SAHV_0657 (graS)
    Mu50:
    SAV0660
    MW2:
    MW0622
    RF122:
    SAB0609
    ST398:
    SAPIG0738
    T0131:
    SAT0131_00730
    TCH60:
    HMPREF0772_12528 (graS)
    TW20:
    SATW20_07350 (graS)
    USA300_TCH1516:
    USA300HOU_0681
    VC40:
    SAVC_02930

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNLKWVAYFLKSRMNWIFWILFLNFLMLGISLIDYDFPIDSLFYIVSLNLSLTMIFLLL
    N315            MNNLKWVAYFLKSRMNWIFWILFLNLLMLGISLIDYDFPIDSLFYIVSLNLSLTMIFLIL
    NCTC8325        MNNLKWVAYFLKSRMNWIFWILFLNFLMLGISLIDYDFPIDSLFYIVSLNLSLTMIFLLL
    Newman          MNNLKWVAYFLKSRMNWIFWILFLNFLMLGISLIDYDFPIDSLFYIVSLNLSLTMIFLLL
    USA300_FPR3757  MNNLKWVAYFLKSRMNWIFWILFLNFLMLGISLIDYDFPIDSLFYIVSLNLSLTMIFLLL
                    *************************:********************************:*

    COL             TYFKEVKLYKHFDKDKEIEEIKHKDLAETPFQRHTVDYLYRQISAHKEKVVEQQLQLNMH
    N315            TYFKEVKLYKHFDKDKEIEEIKHKDLAETPFQRHTVDYLYRQISAHKEKVVEQQLQLNMH
    NCTC8325        TYFKEVKLYKHFDKDKEIEEIKHKDLAETPFQRHTVDYLYRQISAHKEKVVEQQLQLNMH
    Newman          TYFKEVKLYKHFDKDKEIEEIKHKDLAETPFQRHTVDYLYRQISAHKEKVVEQQLQLNMH
    USA300_FPR3757  TYFKEVKLYKHFDKDKEIEEIKHKDLAETPFQRHTVDYLYRQISAHKEKVVEQQLQLNMH
                    ************************************************************

    COL             EQTITEFVHDIKTPVTAMKLLIDQEKNQERKQALLYEWSRINSMLDTQLYITRLESQRKD
    N315            EQTITEFVHDIKTPVTAMKLLIDQEKNQERKQALLYEWSRINSMLDTQLYITRLESQRKD
    NCTC8325        EQTITEFVHDIKTPVTAMKLLIDQEKNQERKQALLYEWSRINSMLDTQLYITRLESQRKD
    Newman          EQTITEFVHDIKTPVTAMKLLIDQEKNQERKQALLYEWSRINSMLDTQLYITRLESQRKD
    USA300_FPR3757  EQTITEFVHDIKTPVTAMKLLIDQEKNQERKQALLYEWSRINSMLDTQLYITRLESQRKD
                    ************************************************************

    COL             MYFDYVSLKRMVIDEIQLTRHISQVKGIGFDVDFKVDDYVYTDIKWCRMIIRQILSNALK
    N315            MYFDYVSLKRMVIDEIQLTRHISQVKGIGFDVDFKVDDYVYTDTKWCRMIIRQILSNALK
    NCTC8325        MYFDYVSLKRMVIDEIQLTRHISQVKGIGFDVDFKVDDYVYTDIKWCRMIIRQILSNALK
    Newman          MYFDYVSLKRMVIDEIQLTRHISQVKGIGFDVDFKVDDYVYTDIKWCRMIIRQILSNALK
    USA300_FPR3757  MYFDYVSLKRMVIDEIQLTRHISQVKGIGFDVDFKVDDYVYTDIKWCRMIIRQILSNALK
                    ******************************************* ****************

    COL             YSENFNIEIGTELNDQHVSLYIKDYGRGISKKDMPRIFERGFTSTANRNETTSSGMGLYL
    N315            YSENFNIEIGTELNDQHVSLYIKDYGRGISKKDMPRIFERGFTSTANRNETTSSGMGLYL
    NCTC8325        YSENFNIEIGTELNDQHVSLYIKDYGRGISKKDMPRIFERGFTSTANRNETTSSGMGLYL
    Newman          YSENFNIEIGTELNDQHVSLYIKDYGRGISKKDMPRIFERGFTSTANRNETTSSGMGLYL
    USA300_FPR3757  YSENFNIEIGTELNDQHVSLYIKDYGRGISKKDMPRIFERGFTSTANRNETTSSGMGLYL
                    ************************************************************

    COL             VNSVKDQLGIHLQVTSTVGKGTTVRLIFPLQNEIVERMSEVTNLSF
    N315            VNSVKDQLGIHLQVTSTVGKGTTVRLIFPLQNEIVERMSEVTNLSF
    NCTC8325        VNSVKDQLGIHLQVTSTVGKGTTVRLIFPLQNEIVERMSEVTNLSF
    Newman          VNSVKDQLGIHLQVTSTVGKGTTVRLIFPLQNEIVERMSEVTNLSF
    USA300_FPR3757  VNSVKDQLGIHLQVTSTVGKGTTVRLIFPLQNEIVERMSEVTNLSF
                    **********************************************