From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002543000
  • symbol?: pitR
  • description?: putative phosphate uptake regulator

      descriptions from strain specific annotations:

    • putative phosphate uptake regulator
    • phosphate transport regulator
    • protein YkaA
    • pit accessory protein
  • strand?: +
  • coordinates?: 3056441..3057058
  • synteny block?: BlockID0017790
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0639
    08BA02176:
    C248_0747
    11819-97:
    MS7_0713
    71193:
    ST398NM01_0741
    ECT-R 2:
    ECTR2_614
    ED133:
    SAOV_0697
    ED98:
    SAAV_0625
    HO 5096 0412:
    SAEMRSA15_05890
    JH1:
    SaurJH1_0702
    JH9:
    SaurJH9_0687
    JKD6008:
    SAA6008_00679
    JKD6159:
    SAA6159_00617
    LGA251:
    SARLGA251_05960
    M013:
    M013TW_0650
    MRSA252:
    SAR0673
    MSHR1132:
    SAMSHR1132_06090
    MSSA476:
    SAS0628
    Mu3:
    SAHV_0660
    Mu50:
    SAV0663
    MW2:
    MW0625
    RF122:
    SAB0612
    ST398:
    SAPIG0741
    T0131:
    SAT0131_00733
    TCH60:
    HMPREF0772_12525
    TW20:
    SATW20_07380
    USA300_TCH1516:
    USA300HOU_0684
    VC40:
    SAVC_02945

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFSKKKDKFMVQLEEMVFNLDRAAIEFGKMDFNTHLDLKAYSDNIKTYESHGDELVHQVI
    N315            MFSKKKDKFMVQLEEMVFNLDRAAIEFGKMDFNTHLDLKAYSDNIKTYESHGDELVHQVI
    NCTC8325        MFSKKKDKFMVQLEEMVFNLDRAAIEFGKMDFNTHLDLKAYSDNIKTYESHGDELVHQVI
    Newman          MFSKKKDKFMVQLEEMVFNLDRAAIEFGKMDFNTHLDLKAYSDNIKTYESHGDELVHQVI
    USA300_FPR3757  MFSKKKDKFMVQLEEMVFNLDRAAIEFGKMDFNTHLDLKAYSDNIKTYESHGDELVHQVI
                    ************************************************************

    COL             TDLNQTFITPIEREDILSLCDAIDDVLDAIEETAAMFEMYSIEYTDEYMAEFVDNIQKAV
    N315            TDLNQTFITPIEREDILSLCDAIDDVLDAIEETAAMFEMYSIEYTDEYMAEFVDNIQKAV
    NCTC8325        TDLNQTFITPIEREDILSLCDAIDDVLDAIEETAAMFEMYSIEYTDEYMAEFVDNIQKAV
    Newman          TDLNQTFITPIEREDILSLCDAIDDVLDAIEETAAMFEMYSIEYTDEYMAEFVDNIQKAV
    USA300_FPR3757  TDLNQTFITPIEREDILSLCDAIDDVLDAIEETAAMFEMYSIEYTDEYMAEFVDNIQKAV
                    ************************************************************

    COL             AEMKLAVGLLVDKKLSHMRIHSINIKEFETNCDGILRQSIKHIFNSETDPITLIKIKDIY
    N315            AEMKLAVGLLVDKKLSHMRIHSINIKEFETNCDGILRQSIKHIFNSETDPITLIKIKDIY
    NCTC8325        AEMKLAVGLLVDKKLSHMRIHSINIKEFETNCDGILRQSIKHIFNSETDPITLIKIKDIY
    Newman          AEMKLAVGLLVDKKLSHMRIHSINIKEFETNCDGILRQSIKHIFNSETDPITLIKIKDIY
    USA300_FPR3757  AEMKLAVGLLVDKKLSHMRIHSINIKEFETNCDGILRQSIKHIFNSETDPITLIKIKDIY
                    ************************************************************

    COL             ESMEEIADKCQIVANNFETIIMKNS
    N315            ESMEEIADKCQIVANNFETIIMKNS
    NCTC8325        ESMEEIADKCQIVANNFETIIMKNS
    Newman          ESMEEIADKCQIVANNFETIIMKNS
    USA300_FPR3757  ESMEEIADKCQIVANNFETIIMKNS
                    *************************