From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003793000
  • symbol?: phoU
  • description?: phosphate transport system regulatory protein PhoU

      descriptions from strain specific annotations:

    • phosphate transport system regulatory protein PhoU
    • phosphate transport system protein PhoU
    • PhoU family transcriptional regulator
    • negative regulator PhoU
    • phosphate transporter PhoU
    • phosphate transport system protein
    • phosphate transport system protein PhoU, putative
    • Phosphate uptake regulator, PhoU
    • phosphate uptake regulator PhoU
    • PhoU protein
    • PnaS family phosphate:sodium (Na+) symporter
    • putative phosphate transport system protein
  • strand?: -
  • coordinates?: 4087382..4088023
  • synteny block?: BlockID0028500
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1296 (phoU)
    USA300_FPR3757:
    04-02981:
    SA2981_1339 (phoU)
    08BA02176:
    C248_1424
    11819-97:
    MS7_1342 (phoU)
    71193:
    ST398NM01_1386
    ECT-R 2:
    ECTR2_1242 (phoU)
    ED133:
    SAOV_1394c
    ED98:
    SAAV_1367
    HO 5096 0412:
    SAEMRSA15_12490
    JH1:
    SaurJH1_1475
    JH9:
    SaurJH9_1446
    JKD6008:
    SAA6008_01349 (phoU)
    JKD6159:
    SAA6159_01252 (phoU)
    LGA251:
    SARLGA251_13020
    M013:
    M013TW_1330
    MRSA252:
    SAR1398
    MSHR1132:
    SAMSHR1132_12270
    MSSA476:
    SAS1326
    Mu3:
    SAHV_1373
    Mu50:
    SAV1385
    MW2:
    MW1273
    RF122:
    SAB1241c
    ST398:
    SAPIG1386 (phoU)
    T0131:
    SAT0131_01456
    TCH60:
    HMPREF0772_11823 (phoU)
    TW20:
    SATW20_13840
    USA300_TCH1516:
    USA300HOU_1319
    VC40:
    SAVC_06170

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAIIRQRYQEQLDDLIKELRRLGANVYVSIENGIKSLSIDDRGFARQTVKNDKHINQLNY
    N315            MAIIRQRYQEQLDDLIKELRRLGANVYVSIENGIKSLSIDDRGFARQTVKNDKHINQLNY
    NCTC8325        MAIIRQRYQEQLDDLIKELRRLGANVYVSIENGIKSLSIDDRGFARQTVKNDKHINQLNY
    Newman          MAIIRQRYQEQLDDLIKELRRLGANVYVSIENGIKSLSIDDRGFARQTVKNDKHINQLNY
    USA300_FPR3757  MAIIRQRYQEQLDDLIKELRRLGANVYVSIENGIKSLSIDDRGFARQTVKNDKHINQLNY
                    ************************************************************

    COL             DINERVIMLITKQQPIASDLRMMISSLKIASDLERIGDNASSIANIRLRTKITDDYVLTR
    N315            DINERVIMLITKQQPIASDLRMMISSLKIASDLERIGDNASSIANIRLRTKITDDYVLTR
    NCTC8325        DINERVIMLITKQQPIASDLRMMISSLKIASDLERIGDNASSIANIRLRTKITDDYVLTR
    Newman          DINERVIMLITKQQPIASDLRMMISSLKIASDLERIGDNASSIANIRLRTKITDDYVLTR
    USA300_FPR3757  DINERVIMLITKQQPIASDLRMMISSLKIASDLERIGDNASSIANIRLRTKITDDYVLTR
                    ************************************************************

    COL             LKTMGKLAMLMLKDLDQAFKKKDTVLIREIIERDEDIDDLYSHIINATYLIDNDPFVAAQ
    N315            LKTMGKLAMLMLKDLDQAFKKKDTVLIREIIERDEDIDDLYSHIINATYLIDNDPFVAAQ
    NCTC8325        LKTMGKLAMLMLKDLDQAFKKKDTVLIREIIERDEDIDDLYSHIINATYLIDNDPFVAAQ
    Newman          LKTMGKLAMLMLKDLDQAFKKKDTVLIREIIERDEDIDDLYSHIINATYLIDNDPFVAAQ
    USA300_FPR3757  LKTMGKLAMLMLKDLDQAFKKKDTVLIREIIERDEDIDDLYSHIINATYLIDNDPFVAAQ
                    ************************************************************

    COL             AHLAARHLERIGDHIINIAESVYFYLTGTHYEQ
    N315            AHLAARHLERIGDHIINIAESVYFYLTGTHYEQ
    NCTC8325        AHLAARHLERIGDHIINIAESVYFYLTGTHYEQ
    Newman          AHLAARHLERIGDHIINIAESVYFYLTGTHYEQ
    USA300_FPR3757  AHLAARHLERIGDHIINIAESVYFYLTGTHYEQ
                    *********************************