From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002564000
  • symbol?:
  • description?: Rossman fold protein, TIGR00730 family

      descriptions from strain specific annotations:

    • Rossman fold protein, TIGR00730 family
    • LOG family protein yvdD
    • Lysine decarboxylase family
    • lysine decarboxylase family protein
    • putative lysine decarboxylase
  • strand?: -
  • coordinates?: 3075859..3076425
  • synteny block?: BlockID0018000
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0657
    08BA02176:
    C248_0765
    11819-97:
    MS7_0732 (yvdD)
    71193:
    ST398NM01_0758
    ECT-R 2:
    ECTR2_632
    ED133:
    SAOV_0715c
    ED98:
    SAAV_0643
    HO 5096 0412:
    SAEMRSA15_06060
    JH1:
    SaurJH1_0720
    JH9:
    SaurJH9_0704
    JKD6008:
    SAA6008_00697
    JKD6159:
    SAA6159_00635
    LGA251:
    SARLGA251_06130
    M013:
    M013TW_0667
    MRSA252:
    SAR0733
    MSHR1132:
    SAMSHR1132_06260
    MSSA476:
    SAS0645
    Mu3:
    SAHV_0677
    Mu50:
    SAV0680
    MW2:
    MW0642
    RF122:
    SAB0629c
    ST398:
    SAPIG0758
    T0131:
    SAT0131_00751
    TCH60:
    HMPREF0772_12507
    TW20:
    SATW20_07550
    USA300_TCH1516:
    USA300HOU_0703
    VC40:
    SAVC_03030

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKRIAVYCGASKGHDPSYVQKAYDLGKYFAEQGYELVFGAGSIGIMGAIQDGVLDHGGKA
    N315            MKRIAVYCGASKGHDPSYVQKAYDLGKYFAEQGYELVFGAGSIGIMGAIQDGVLNHGGKA
    NCTC8325        MKRIAVYCGASKGHDPSYVQKAYDLGKYFAEQGYELVFGAGSIGIMGAIQDGVLDHGGKA
    Newman          MKRIAVYCGASKGHDPSYVQKAYDLGKYFAEQGYELVFGAGSIGIMGAIQDGVLDHGGKA
    USA300_FPR3757  MKRIAVYCGASKGHDPSYVQKAYDLGKYFAEQGYELVFGAGSIGIMGAIQDGVLDHGGKA
                    ******************************************************:*****

    COL             IGVMPKMLDEHEITSQRLTELILVDSMHERKNKMAELADAFVMAPGGAGSLEEFFEMYSW
    N315            IGVMPKMLDEHEITSQRLTELILVDSMHERKNKMAELADAFVMAPGGAGSLEEFFEMYSW
    NCTC8325        IGVMPKMLDEHEITSQRLTELILVDSMHERKNKMAELADAFVMAPGGAGSLEEFFEMYSW
    Newman          IGVMPKMLDEHEITSQRLTELILVDSMHERKNKMAELADAFVMAPGGAGSLEEFFEMYSW
    USA300_FPR3757  IGVMPKMLDEHEITSQRLTELILVDSMHERKNKMAELADAFVMAPGGAGSLEEFFEMYSW
                    ************************************************************

    COL             AQIGIHEKPIAIYNINGFFNPLQTMIDHMIEEGFIDPKYRALAPLCDTKESLIESILNFK
    N315            AQIGIHEKPIAIYNINGFFNPLQTMIDHMIEEGFIDPKYRALAPLCDTKESLIESILNFK
    NCTC8325        AQIGIHEKPIAIYNINGFFNPLQTMIDHMIEEGFIDPKYRALAPLCDTKESLIESILNFK
    Newman          AQIGIHEKPIAIYNINGFFNPLQTMIDHMIEEGFIDPKYRALAPLCDTKESLIESILNFK
    USA300_FPR3757  AQIGIHEKPIAIYNINGFFNPLQTMIDHMIEEGFIDPKYRALAPLCDTKESLIESILNFK
                    ************************************************************

    COL             PLGTRSYD
    N315            PLGTRSYD
    NCTC8325        PLGTRSYD
    Newman          PLGTRSYD
    USA300_FPR3757  PLGTRSYD
                    ********