From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002569000
  • symbol?:
  • description?: cysteine ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • cysteine ABC transporter ATP-binding protein
    • ABC transporter ATP-binding protein
    • ABC transporter ATP-binding MsbA family protein
    • Transport ATP-binding protein CydC
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter
    • ABC transporter, ATP-binding MsbA family protein
    • ABC transporter family protein
    • MsbA family ABC superfamily ATP binding cassette transporter, ABC protein
  • strand?: +
  • coordinates?: 3080467..3082148
  • synteny block?: BlockID0018050
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0662 (cydC)
    08BA02176:
    C248_0770
    11819-97:
    MS7_0737
    71193:
    ST398NM01_0763
    ECT-R 2:
    ECTR2_637
    ED133:
    SAOV_0720
    ED98:
    SAAV_0648
    HO 5096 0412:
    SAEMRSA15_06110
    JH1:
    SaurJH1_0725
    JH9:
    SaurJH9_0709
    JKD6008:
    SAA6008_00702
    JKD6159:
    SAA6159_00640
    LGA251:
    SARLGA251_06180
    M013:
    M013TW_0672
    MRSA252:
    SAR0738
    MSHR1132:
    SAMSHR1132_06310
    MSSA476:
    SAS0650
    Mu3:
    SAHV_0682
    Mu50:
    SAV0685
    MW2:
    MW0647
    RF122:
    SAB0634
    ST398:
    SAPIG0763
    T0131:
    SAT0131_00756
    TCH60:
    HMPREF0772_12502
    TW20:
    SATW20_07600
    USA300_TCH1516:
    USA300HOU_0708
    VC40:
    SAVC_03060

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKTRLKFQVDKDLLLAIVVGVCGSLVALAMFFLSGYMVTQSALGAPLYALMILVVTVKLF
    N315            MKTRLKFQVDKDLLLAIVVGVCGSLVALAMFFLSGYMVTQSALGAPLYALMILVVTVKLF
    NCTC8325        MKTRLKFQVDKDLLLAIVVGVCGSLVALAMFFLSGYMVTQSALGAPLYALMILVVTVKLF
    Newman          MKTRLKFQVDKDLLLAIVVGVCGSLVALAMFFLSGYMVTQSALGAPLYALMILVVTVKLF
    USA300_FPR3757  MKTRLKFQVDKDLLLAIVVGVCGSLVALAMFFLSGYMVTQSALGAPLYALMILVVTVKLF
                    ************************************************************

    COL             GFLRAITRYVERLISHKATFTMLRDIRVQFFGKLVNVIPNVYRKLSSSDLISRMISRVEA
    N315            GFLRAITRYVERLISHKATFTMLRDIRVQFFGKLVNVIPNVYRKLSSSDLISRMISRVEA
    NCTC8325        GFLRAITRYVERLISHKATFTMLRDIRVQFFGKLVNVIPNVYRKLSSSDLISRMISRVEA
    Newman          GFLRAITRYVERLISHKATFTMLRDIRVQFFGKLVNVIPNVYRKLSSSDLISRMISRVEA
    USA300_FPR3757  GFLRAITRYVERLISHKATFTMLRDIRVQFFGKLVNVIPNVYRKLSSSDLISRMISRVEA
                    ************************************************************

    COL             LQNIYLRVYYPPVVIGLTALVTVIVLAFISIGHALLIMVSMLFTLLIVPWLSSKKARTLK
    N315            LQNIYLRVYYPPVVIGLTALVTVIVLAFISIGHALLIMVSMLFTLLIVPWLSSKKARTLK
    NCTC8325        LQNIYLRVYYPPVVIGLTALVTVIVLAFISIGHALLIMVSMLFTLLIVPWLSSKKARTLK
    Newman          LQNIYLRVYYPPVVIGLTALVTVIVLAFISIGHALLIMVSMLFTLLIVPWLSSKKARTLK
    USA300_FPR3757  LQNIYLRVYYPPVVIGLTALVTVIVLAFISIGHALLIMVSMLFTLLIVPWLSSKKARTLK
                    ************************************************************

    COL             KHAANEQARFLNHFYDYKAGMDELRRFNQINHYRDNLMAKLNHFDKLQLKEQRFLTIYDF
    N315            KHAANEQARFLNHFYDYKAGMDELRRFNQINHYRDNLMAKLNHFDKLQLKEQRFLTIYDF
    NCTC8325        KHAANEQARFLNHFYDYKAGMDELRRFNQINHYRDNLMAKLNHFDKLQLKEQRFLTIYDF
    Newman          KHAANEQARFLNHFYDYKAGMDELRRFNQINHYRDNLMAKLNHFDKLQLKEQRFLTIYDF
    USA300_FPR3757  KHAANEQARFLNHFYDYKAGMDELRRFNQINHYRDNLMAKLNHFDKLQLKEQRFLTIYDF
                    ************************************************************

    COL             ILNIIAMLSIFGSLVLGLIQINAGQLNIIYMTSIVLMVLTLFEQAVPMTNVAYYKADTDQ
    N315            ILNIIAMLSIFGSLVLGLIQINAGQLNIIYMTSIVLMILTLFEQAVPMTNVAYYKADTDQ
    NCTC8325        ILNIIAMLSIFGSLVLGLIQINAGQLNIIYMTSIVLMVLTLFEQAVPMTNVAYYKADTDQ
    Newman          ILNIIAMLSIFGSLVLGLIQINAGQLNIIYMTSIVLMVLTLFEQAVPMTNVAYYKADTDQ
    USA300_FPR3757  ILNIIAMLSIFGSLVLGLIQINAGQLNIIYMTSIVLMVLTLFEQAVPMTNVAYYKADTDQ
                    *************************************:**********************

    COL             ALHDINEVISVPSTNGKKRLNDKYDATNIYEVKDASFKYWNQQTYVLSDINFNVNRGEKI
    N315            ALHDINEVISVPSTNGKKRLNDKYDATNIYEVKDASFKYWNQQTYVLSDINFNVNRGEKI
    NCTC8325        ALHDINEVISVPSTNGKKRLNDKYDATNIYEVKDASFKYWNQQTYVLSDINFNVNRGEKI
    Newman          ALHDINEVISVPSTNGKKRLNDKYDATNIYEVKDASFKYWNQQTYVLSDINFNVNRGEKI
    USA300_FPR3757  ALHDINEVISVPSTNGKKRLNDKYDATNIYEVKDASFKYWNQQTYVLSDINFNVNRGEKI
                    ************************************************************

    COL             AIVGPSGSGKSTLLQIMAGLYQLDSGSVRFENMDMFEIDDKDKFESLNVLLQSQQLFDGT
    N315            AIVGPSGSGKSTLLQIMAGLYQLDSGSVRFENMDMFEIDDKDKFESLNVLLQSQQLFDGT
    NCTC8325        AIVGPSGSGKSTLLQIMAGLYQLDSGSVRFENMDMFEIDDKDKFESLNVLLQSQQLFDGT
    Newman          AIVGPSGSGKSTLLQIMAGLYQLDSGSVRFENMDMFEIDDKDKFESLNVLLQSQQLFDGT
    USA300_FPR3757  AIVGPSGSGKSTLLQIMAGLYQLDSGSVRFENMDMFEIDDKDKFESLNVLLQSQQLFDGT
                    ************************************************************

    COL             IRQNLFTDEKDEAVQAIFKQLDLEHLALERQIDLDGHTLSGGEIQRLAITRMLLKDTAST
    N315            IRQNLFTDEKDEAVQAIFKQLDLEHLALERQIDLDGHTLSGGEIQRLAITRMLLKDTAST
    NCTC8325        IRQNLFTDEKDEAVQAIFKQLDLEHLALERQIDLDGHTLSGGEIQRLAITRMLLKDTAST
    Newman          IRQNLFTDEKDEAVQAIFKQLDLEHLALERQIDLDGHTLSGGEIQRLAITRMLLKDTAST
    USA300_FPR3757  IRQNLFTDEKDEAVQAIFKQLDLEHLALERQIDLDGHTLSGGEIQRLAITRMLLKDTAST
                    ************************************************************

    COL             WILDEPTTALDKQNSLKVMDLIEAHAETLIVATHDLTLLSRFETIIVMINGKIVEKGNYQ
    N315            WILDEPTTALDKQNSLKVMDLIEAHAETLIVATHDLTLLSRFETIIVMINGKIVEKGNYQ
    NCTC8325        WILDEPTTALDKQNSLKVMDLIEAHAETLIVATHDLTLLSRFETIIVMINGKIVEKGNYQ
    Newman          WILDEPTTALDKQNSLKVMDLIEAHAETLIVATHDLTLLSRFETIIVMINGKIVEKGNYQ
    USA300_FPR3757  WILDEPTTALDKQNSLKVMDLIEAHAETLIVATHDLTLLSRFETIIVMINGKIVEKGNYQ
                    ************************************************************

    COL             QLLANQGALWNMIQYNA
    N315            QLLANQGALWNMIQYNA
    NCTC8325        QLLANQGALWNMIQYNA
    Newman          QLLANQGALWNMIQYNA
    USA300_FPR3757  QLLANQGALWNMIQYNA
                    *****************