From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002570000
  • symbol?: mgrA
  • description?: MarR family transcriptional regulator

      descriptions from strain specific annotations:

    • MarR family transcriptional regulator
    • MarR family regulatory protein
    • HTH-type transcriptional regulator mgrA
    • marR family protein
    • transcriptional regulator
    • transcriptional regulator MgrA
    • Transcriptional regulator MgrA (Regulator of autolytic activity)
  • strand?: -
  • coordinates?: 3082278..3082721
  • synteny block?: BlockID0018060
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0746 (norR)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0663 (mgrA)
    08BA02176:
    C248_0771
    11819-97:
    MS7_0738 (mgrA)
    71193:
    ST398NM01_0764
    ECT-R 2:
    ECTR2_638
    ED133:
    SAOV_0721
    ED98:
    SAAV_0649 (norR)
    HO 5096 0412:
    SAEMRSA15_06120
    JH1:
    SaurJH1_0726
    JH9:
    SaurJH9_0710
    JKD6008:
    SAA6008_00703
    JKD6159:
    SAA6159_00641
    LGA251:
    SARLGA251_06190 (mgrA)
    M013:
    M013TW_0673
    MRSA252:
    SAR0739
    MSHR1132:
    SAMSHR1132_06320
    MSSA476:
    SAS0651
    Mu3:
    SAHV_0683 (mgrA)
    Mu50:
    SAV0686
    MW2:
    MW0648
    RF122:
    SAB0635c
    ST398:
    SAPIG0764
    T0131:
    SAT0131_00757 (fadE)
    TCH60:
    HMPREF0772_12501 (norR)
    TW20:
    SATW20_07610 (mgrA)
    USA300_TCH1516:
    USA300HOU_0709
    VC40:
    SAVC_03065

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSDQHNLKEQLCFSLYNAQRQVNRYYSNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVT
    N315            MSDQHNLKEQLCFSLYNAQRQVNRYYSNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVT
    NCTC8325        MSDQHNLKEQLCFSLYNAQRQVNRYYSNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVT
    Newman          MSDQHNLKEQLCFSLYNAQRQVNRYYSNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVT
    USA300_FPR3757  MSDQHNLKEQLCFSLYNAQRQVNRYYSNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVT
                    ************************************************************

    COL             ELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASAS
    N315            ELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASAS
    NCTC8325        ELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASAS
    Newman          ELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASAS
    USA300_FPR3757  ELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASAS
                    ************************************************************

    COL             SLSQDEVKELNRLLGKVIHAFDETKEK
    N315            SLSQDEVKELNRLLGKVIHAFDETKEK
    NCTC8325        SLSQDEVKELNRLLGKVIHAFDETKEK
    Newman          SLSQDEVKELNRLLGKVIHAFDETKEK
    USA300_FPR3757  SLSQDEVKELNRLLGKVIHAFDETKEK
                    ***************************