From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0655 [new locus tag: NWMN_RS03715 ]
  • pan locus tag?: SAUPAN002570000
  • symbol: NWMN_0655
  • pan gene symbol?: mgrA
  • synonym:
  • product: MarR family regulatory protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0655 [new locus tag: NWMN_RS03715 ]
  • symbol: NWMN_0655
  • product: MarR family regulatory protein
  • replicon: chromosome
  • strand: -
  • coordinates: 736757..737200
  • length: 444
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGTCTGATCAACATAATTTAAAAGAACAGCTATGCTTTAGTTTGTACAATGCTCAAAGA
    CAAGTTAATCGCTACTACTCTAACAAAGTTTTTAAGAAGTACAATCTAACATACCCACAA
    TTTCTTGTCTTAACAATTTTATGGGATGAATCTCCTGTAAACGTCAAGAAAGTCGTAACT
    GAATTAGCACTCGATACTGGTACAGTATCACCATTATTAAAACGAATGGAACAAGTAGAC
    TTAATTAAGCGTGAACGTTCCGAAGTCGATCAACGTGAAGTATTTATTCACTTGACTGAC
    AAAAGTGAAACTATTAGACCAGAATTAAGTAATGCATCTGACAAAGTCGCTTCAGCTTCT
    TCTTTATCGCAAGATGAAGTTAAAGAACTTAATCGCTTATTAGGTAAAGTCATTCATGCA
    TTTGATGAAACAAAGGAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    444

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0655 [new locus tag: NWMN_RS03715 ]
  • symbol: NWMN_0655
  • description: MarR family regulatory protein
  • length: 147
  • theoretical pI: 7.59928
  • theoretical MW: 17089.3
  • GRAVY: -0.564626

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 54.1)
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 51.6)
    Signal transductionRegulatory functionsDNA interactionsstaphylococcal accessory regulator family (TIGR01889; HMM-score: 47.2)
  • TheSEED:  
    Transcriptional regulator MgrA (Regulator of autolytic activity) 
  • PFAM:
    HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 53.9)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 33.1)
    Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 25.8)
    MarR_2; MarR family (PF12802; HMM-score: 24.1)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 18.6)
    PadR; Transcriptional regulator PadR-like family (PF03551; HMM-score: 14.6)
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 12.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_0168(fadB)3-hydroxyacyl-CoA dehydrogenase FadB-like protein  [1] (data from MRSA252)
    NWMN_1549(rplU)50S ribosomal protein L21  [1] (data from MRSA252)
    NWMN_1325(sucB)dihydrolipoamide succinyltransferase  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.114
    • Ymax_pos: 58
    • Cmax: 0.119
    • Cmax_pos: 58
    • Smax: 0.155
    • Smax_pos: 1
    • Smean: 0.11
    • D: 0.112
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSDQHNLKEQLCFSLYNAQRQVNRYYSNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASASSLSQDEVKELNRLLGKVIHAFDETKEK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_0655 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]