From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002575000
  • symbol?:
  • description?: Deoxyribodipyrimidine photolyase

      descriptions from strain specific annotations:

    • Deoxyribodipyrimidine photolyase
    • FAD binding domain of DNA photolyase protein
    • DNA photolyase family protein
    • deoxyribodipyrimidine photolyase, putative
    • FAD binding domain of DNA photolyase family protein
    • putative deoxyribodipyrimidine photolyase
    • putative DNA photolyase
  • strand?: +
  • coordinates?: 3087228..3088831
  • synteny block?: BlockID0018110
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0668
    08BA02176:
    C248_0776
    11819-97:
    MS7_0743
    71193:
    ST398NM01_0769
    ECT-R 2:
    ECTR2_643
    ED133:
    SAOV_0726
    ED98:
    SAAV_0654
    HO 5096 0412:
    SAEMRSA15_06170
    JH1:
    SaurJH1_0731
    JH9:
    SaurJH9_0715
    JKD6008:
    SAA6008_00708 (phrB)
    JKD6159:
    SAA6159_00646 (phrB)
    LGA251:
    SARLGA251_06240
    M013:
    M013TW_0678
    MRSA252:
    SAR0744
    MSHR1132:
    SAMSHR1132_06370
    MSSA476:
    SAS0656
    Mu3:
    SAHV_0688
    Mu50:
    SAV0691
    MW2:
    MW0653
    RF122:
    SAB0640
    ST398:
    SAPIG0769
    T0131:
    SAT0131_00762
    TCH60:
    HMPREF0772_12496 (phrB)
    TW20:
    SATW20_07660
    USA300_TCH1516:
    USA300HOU_0714 (phrB)
    VC40:
    SAVC_03090

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAIAVLLNRMFRMEHNPLFEYIYQQKEDIDACYFIIPEEDMSSASDLKAQFYRGTLQRFY
    N315            MAIAVLLNRMFRMEHNPLFEYIYQQKEDIDACYFIIPEEDMSSASDLKAQFYRGTLQRFY
    NCTC8325        MAIAVLLNRMFRMEHNPLFEYIYQQKEDIDACYFIIPEEDMSSASDLKAQFYRGTLQRFY
    Newman          MAIAVLLNRMFRMEHNPLFEYIYQQKEDIDACYFIIPEEDMSSASDLKAQFYRGTLQRFY
    USA300_FPR3757  MAIAVLLNRMFRMEHNPLFEYIYQQKEDIDACYFIIPEEDMSSASDLKAQFYRGTLQRFY
                    ************************************************************

    COL             QSLHAEKLTPYVMSYDDIISFCKENNISEVVTAGDIMSYHLEEYDILHQRSLFNEARIAV
    N315            QSLHAEKLTPYVMSYDDIISFCKENNISEVVIAGDIMSYHLEEYDILHQRSLFNEARIAV
    NCTC8325        QSLHAEKLTPYVMSYDDIISFCKENNISEVVTAGDIMSYHLEEYDILHQRSLFNEARIAV
    Newman          QSLHAEKLTPYVMSYDDIISFCKENNISEVVTAGDIMSYHLEEYDILHQRSLFNEARIAV
    USA300_FPR3757  QSLHAEKLTPYVMSYDDIISFCKENNISEVVTAGDIMSYHLEEYDILHQRSLFNEARIAV
                    ******************************* ****************************

    COL             TLIRGNHYFKASKTMNQQGEPYNVFTSFYKKWRPYLRHRDVYHYDLKSFEDFVIASPDDL
    N315            TLIRGNHYFKASKTMNQQGEPYKVFTSFYRKWRPYLRHRDVYHYDLKSFEDFVIASPDDL
    NCTC8325        TLIRGNHYFKASKTMNQQGEPYNVFTSFYKKWRPYLRHRDVYHYDLKSFENFVIASPDDL
    Newman          TLIRGNHYFKASKTMNQQGEPYNVFTSFYKKWRPYLRHRDVYHYDLKSFEDFVIASPDDL
    USA300_FPR3757  TLIRGNHYFKASKTMNQQGEPYNVFTSFYKKWRPYLRHRDVYHYDLKSFEDFVIASPDDL
                    **********************:******:********************:*********

    COL             VFDDIAFGSSQIIEQNKWQHFLDQDIQNYESGRDYLPEVLTSQLSVALAYGLLDIIEIFN
    N315            VFDDIAFGSSQVIEQNKWQHFLDQDIQNYESGRDYLPEVLTSQLSVALAYGLLDIIEIFN
    NCTC8325        VFDDIAFGSSQIIEQNKWQHFLDQDIQNYESGRDYLPEVLTSQLSVALAYGLLDIIEIFN
    Newman          VFDDIAFGSSQIIEQNKWQHFLDQDIQNYESGRDYLPEVLTSQLSVALAYGLLDIIEIFN
    USA300_FPR3757  VFDDIAFGSSQIIEQNKWQHFLDQDIQNYESGRDYLPEVLTSQLSVALAYGLLDIIEIFN
                    ***********:************************************************

    COL             DLLARYDEDEANYEAFIRELIFREFYYVLMTQYPETSYQAFKPKYRQIKWSQNEADFNAW
    N315            DLLARYDEDEANHEAFIRELIFREFYYVLMTQYPETSYQAFKPKYRQIKWSQNEANFNAW
    NCTC8325        DLLARYDEDEANYEAFIRELIFREFYYVLMTQYPETSYQAFKPKYRQIKWSQNEADFNAW
    Newman          DLLARYDEDEANYEAFIRELIFREFYYVLMTQYPETSYQAFKPKYRQIKWSQNEADFNAW
    USA300_FPR3757  DLLARYDEDEANYEAFIRELIFREFYYVLMTQYPETSYQAFKPKYRQIKWSQNEADFNAW
                    ************:******************************************:****

    COL             CEGQTGFPIIDAAIMELTQTGFMHNRMRMVVSQFLTKDLFIDWTWGEKFFRKHLIDYDAA
    N315            CEGQTGFPIIDAAIMELTQTGFMHNRMRMVVSQFLTKDLFIDWTWGEKFFRKHLIDYDAA
    NCTC8325        CEGQTGFPIIDAAIMELTQTGFMHNRMRMVVSQFLTKDLFIDWTWGEKFFRKHLIDYDAA
    Newman          CEGQTGFPIIDAAIMELTQTGFMHNRMRMVVSQFLTKDLFIDWTWGEKFFRKHLIDYDAA
    USA300_FPR3757  CEGQTGFPIIDAAIMELTQTGFMHNRMRMVVSQFLTKDLFIDWTWGEKFFRKHLIDYDAA
                    ************************************************************

    COL             SNIHGWQWSASTGTDAVPYFRMFNPIRQSERFDAKALYIKTYLPIFNQIDAKYLHDTQRN
    N315            SNIHGWQWSASTGTDAVPYFRMFNPIRQSERFDAKALYIKTYLPIFNQIDAKYLHDTQRN
    NCTC8325        SNIHGWQWSASTGTDAVPYFRMFNPIRQSERFDAKALYIKTYLPIFNQIDAKYLHDTQRN
    Newman          SNIHGWQWSASTGTDAVPYFRMFNPIRQSERFDAKALYIKTYLPIFNQIDAKYLHDTQRN
    USA300_FPR3757  SNIHGWQWSASTGTDAVPYFRMFNPIRQSERFDAKALYIKTYLPIFNQIDAKYLHDTQRN
                    ************************************************************

    COL             ESNLFEQGIELGSHYPRQMVDHQEKRTQVLATFKALD
    N315            ESNLFEQGIELGSHYPRQMVDHQEKRTQVLATFKALD
    NCTC8325        ESNLFEQGIELGSHYPRQMVDHQEKRTQVLATFKALD
    Newman          ESNLFEQGIELGSHYPRQMVDHQEKRTQVLATFKALD
    USA300_FPR3757  ESNLFEQGIELGSHYPRQMVDHQEKRTQVLATFKALD
                    *************************************