From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002577000
  • symbol?:
  • description?: Integral membrane protein

      descriptions from strain specific annotations:

    • Integral membrane protein
    • Permease
  • strand?: -
  • coordinates?: 3089620..3090237
  • synteny block?: BlockID0018130
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0670
    08BA02176:
    C248_0777
    11819-97:
    MS7_0744
    71193:
    ST398NM01_0770
    ECT-R 2:
    ECTR2_644
    ED133:
    SAOV_0727c
    ED98:
    SAAV_0655
    HO 5096 0412:
    SAEMRSA15_06190
    JH1:
    SaurJH1_0733
    JH9:
    SaurJH9_0717
    JKD6008:
    SAA6008_00709
    JKD6159:
    SAA6159_00648
    LGA251:
    SARLGA251_06260
    M013:
    M013TW_0679
    MRSA252:
    SAR0746
    MSHR1132:
    SAMSHR1132_06380
    MSSA476:
    SAS0658
    Mu3:
    SAHV_0690
    Mu50:
    SAV0693
    MW2:
    MW0655
    RF122:
    SAB0642c
    ST398:
    SAPIG0770
    T0131:
    SAT0131_00763 (fadX)
    TCH60:
    HMPREF0772_12494
    TW20:
    SATW20_07680
    USA300_TCH1516:
    USA300HOU_0716
    VC40:
    SAVC_03100

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MQSRYIARIYFLILFIVSLFETKIFQFMTLNLFLAYIPFELSLLLRLFKPNKKYEWPLF
    N315            MMQSRYIARIYFLILFIVSLFETKIFQFMTLNLFLAYIPFELSLLLRLFKPNKKYEWPLF
    NCTC8325        -MQSRYIARIYFLILFIVSLFETKIFQFMTLNLFLAYIPFELSLLLRLFKPNKKYEWPLF
    Newman          MMQSRYIARIYFLILFIVSLFETKIFQFMTLNLFLAYIPFELSLLLRLFKPNKKYEWPLF
    USA300_FPR3757  -MQSRYIARIYFLILFIVSLFETKIFQFMTLNLFLAYIPFELSLLLRLFKPNKKYEWPLF
                     ***********************************************************

    COL             IIYSFIFVLLLPNTFYMVTDLIHLNQFQFNFYAGLNLSEWKYFTYLLLGVFLAVYVMILI
    N315            IIYSFIFVLLLPNTFYMVTDLIHLNQFQFNFYAGLNLSEWKYFTYLLLGVFLAVYVMILI
    NCTC8325        IIYSFIFVLLLPNTFYMVTDLIHLNQFQFNFYAGLNLSEWKYFTYLLLGVFLAVYVMILI
    Newman          IIYSFIFVLLLPNTFYMVTDLIHLNQFQFNFYAGLNLSEWKYFTYLLLGVFLAVYVMILI
    USA300_FPR3757  IIYSFIFVLLLPNTFYMVTDLIHLNQFQFNFYAGLNLSEWKYFTYLLLGVFLAVYVMILI
                    ************************************************************

    COL             YFEILTLTSHRWLNRLIVVVLMFLNGFGIYIGRFLRLHSVYFFNEPLHVLNHILESLTLK
    N315            YFEILTLTSHRWLNRLIVVVLMFLNGFGIYIGRFLRLHSVYFFNEPLHVLNHILESLTLK
    NCTC8325        YFEILTLTSHRWLNRLIVVVLMFLNGFGIYIGRFLRLHSVYFFNEPLHVLNHILESLTLK
    Newman          YFEILTLTSHRWLNRLIVVVLMFLNGFGIYIGRFLRLHSVYFFNEPLHVLNHILESLTLK
    USA300_FPR3757  YFEILTLTSHRWLNRLIVVVLMFLNGFGIYIGRFLRLHSVYFFNEPLHVLNHILESLTLK
                    ************************************************************

    COL             TAMFVCFMVVMQAAILLFGKGVRLNK
    N315            TAMFVCFMVVMQAAILLFGKGVRLNK
    NCTC8325        TAMFVCFMVVMQAAILLFGKGVRLNK
    Newman          TAMFVCFMVVMQAAILLFGKGVRLNK
    USA300_FPR3757  TAMFVCFMVVMQAAILLFGKGVRLNK
                    **************************