From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002580000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3092632..3093099
  • synteny block?: BlockID0018160
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0673
    08BA02176:
    C248_0780
    11819-97:
    MS7_0747
    71193:
    ST398NM01_0773
    ECT-R 2:
    ECTR2_647
    ED133:
    SAOV_0730
    ED98:
    SAAV_0658
    HO 5096 0412:
    SAEMRSA15_06220
    JH1:
    SaurJH1_0736
    JH9:
    SaurJH9_0720
    JKD6008:
    SAA6008_00712
    JKD6159:
    SAA6159_00651
    LGA251:
    SARLGA251_06290
    M013:
    M013TW_0682
    MRSA252:
    SAR0749
    MSHR1132:
    SAMSHR1132_06410
    MSSA476:
    SAS0661
    Mu3:
    SAHV_0693
    Mu50:
    SAV0696
    MW2:
    MW0658
    RF122:
    SAB0645
    ST398:
    SAPIG0773
    T0131:
    SAT0131_00766
    TCH60:
    HMPREF0772_12491
    TW20:
    SATW20_07710
    USA300_TCH1516:
    USA300HOU_0719
    VC40:
    SAVC_03115

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTVKNLFLGFVAVILTVCLIGLLILATNEDALAKVHKTINTLNAINVSTEDTYKKKMDIL
    N315            MTVKNLFLGFVAVILTVCLIGLLILATNEDALAKVHKTINTLNAINVSTEDTYKKKMDIL
    NCTC8325        MTVKNLFLGFVAVILTVCLIGLLILATNEDALAKVHKTINTLNAINVSTEDTYKKKMDIL
    Newman          MTVKNLFLGFVAVILTVCLIGLLILATNEDALAKVHKTINTLNAINVSTEDTYKKKMDIL
    USA300_FPR3757  MTVKNLFLGFVAVILTVCLIGLLILATNEDALAKVHKTINTLNAINVSTEDTYKKKMDIL
                    ************************************************************

    COL             NIHTAKASEVNENVKKQNHFKHRVNANKSNSFNEQECQVIADRYADKHINDNYGLERISK
    N315            NIHTAKASEVNENVEKQNHFKHRVNANKSNSFNEQECQVIADRYADKHINDNYGLERISK
    NCTC8325        NIHTAKASEVNENVKKQNHFKHRVNANKSNSFNEQECQVIADRYADKHINDNYGLERISK
    Newman          NIHTAKASEVNENVKKQNHFKHRVNANKSNSFNEQECQVIADRYADKHINDNYGLERISK
    USA300_FPR3757  NIHTAKASEVNENVKKQNHFKHRVNANKSNSFNEQECQVIADRYADKHINDNYGLERISK
                    **************:*********************************************

    COL             TNHGYNYVYSNDNSTSKQHVSISNQGIITK
    N315            TNHGYNYVYSNDNSTSKQHVSISNQGIITK
    NCTC8325        TNHGYNYVYSNDNSTSKQHVSISNQGIITK
    Newman          TNHGYNYVYSNDNSTSKQHVSISNQGIITK
    USA300_FPR3757  TNHGYNYVYSNDNSTSKQHVSISNQGIITK
                    ******************************