From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002583000
  • symbol?: fruB
  • description?: fructose 1-phosphate kinase

      descriptions from strain specific annotations:

    • fructose 1-phosphate kinase
    • 1-phosphofructokinase
    • putative phosphofructokinase
  • strand?: +
  • coordinates?: 3094818..3095738
  • synteny block?: BlockID0018190
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0758 (fruK)
    N315:
    SA0654 (fruB)
    NCTC8325:
    Newman:
    NWMN_0668 (fruB)
    USA300_FPR3757:
    04-02981:
    SA2981_0676 (fruB)
    08BA02176:
    C248_0783
    11819-97:
    MS7_0750 (pfkB)
    71193:
    ST398NM01_0776
    ECT-R 2:
    ECTR2_650 (pfkB)
    ED133:
    SAOV_0733
    ED98:
    SAAV_0661 (fruK)
    HO 5096 0412:
    SAEMRSA15_06250
    JH1:
    SaurJH1_0739
    JH9:
    SaurJH9_0723
    JKD6008:
    SAA6008_00715 (pfkB)
    JKD6159:
    SAA6159_00654 (pfkB)
    LGA251:
    SARLGA251_06320
    M013:
    M013TW_0685
    MRSA252:
    SAR0752
    MSHR1132:
    SAMSHR1132_06440
    MSSA476:
    SAS0664
    Mu3:
    SAHV_0696 (fruB)
    Mu50:
    SAV0699 (fruB)
    MW2:
    MW0661 (fruB)
    RF122:
    SAB0648
    ST398:
    SAPIG0776 (pfkB)
    T0131:
    SAT0131_00769
    TCH60:
    HMPREF0772_12488 (pfkB)
    TW20:
    SATW20_07740
    USA300_TCH1516:
    USA300HOU_0722 (fruK)
    VC40:
    SAVC_03130

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIYTVTFNPSIDYVIFTNDFKIDGLNRATATYKFAGGKGINVSRVLKTLDVESTALGFAG
    N315            MIYTVTFNPSIDYVIFTNDFKIDGLNRATATYKFAGGKGINVSRVLKTLDVESTALGFAG
    NCTC8325        MIYTVTFNPSIDYVIFTNDFKIDGLNRATATYKFAGGKGINVSRVLKTLDVESTALGFAG
    Newman          MIYTVTFNPSIDYVIFTNDFKIDGLNRATATYKFAGGKGINVSRVLKTLDVESTALGFAG
    USA300_FPR3757  MIYTVTFNPSIDYVIFTNDFKIDGLNRATATYKFAGGKGINVSRVLKTLDVESTALGFAG
                    ************************************************************

    COL             GFPGKFIIDTLNNSAIQSNFIEVDEDTRINVKLKTGQETEINAPGPHITSTQFEQLLQQI
    N315            GFPGKFIIDTLNNSAIQSNFIEVDEDTRINVKLKTGQETEINAPGPHITSTQFEQLLQQI
    NCTC8325        GFPGKFIIDTLNNSAIQSNFIEVDEDTRINVKLKTGQETEINAPGPHITSTQFEQLLQQI
    Newman          GFPGKFIIDTLNNSAIQSNFIEVDEDTRINVKLKTGQETEINAPGPHITSTQFEQLLQQI
    USA300_FPR3757  GFPGKFIIDTLNNSAIQSNFIEVDEDTRINVKLKTGQETEINAPGPHITSTQFEQLLQQI
                    ************************************************************

    COL             KNTTSEDIVIVAGSVPSSIPSDAYAQIAQITAQTGAKLVVDAEKELAESVLPYHPLFIKP
    N315            KNTTSEDIVIVAGSVPSSIPSDAYAQIAQITAQTGAKLVVDAEKELAESVLPFHPLFIKP
    NCTC8325        KNTTSEDIVIVAGSVPSSIPSDAYAQIAQITAQTGAKLVVDAEKELAESVLPYHPLFIKP
    Newman          KNTTSEDIVIVAGSVPSSIPSDAYAQIAQITAQTGAKLVVDAEKELAESVLPYHPLFIKP
    USA300_FPR3757  KNTTSEDIVIVAGSVPSSIPSDAYAQIAQITAQTGAKLVVDAEKELAESVLPYHPLFIKP
                    ****************************************************:*******

    COL             NKDELEVMFNTTVNSDTDVIKYGRLLVDKGAQSVIVSLGGDGAIYIDKEISIKAVNPQGK
    N315            NKDELEVMFNTTVNSDTDVIKYGRLLVDKGAQSVIVSLGGDGAIYIDKEISIKAVNPQGK
    NCTC8325        NKDELEVMFNTTVNSDTDVIKYGRLLVDKGAQSVIVSLGGDGAIYIDKEISIKAVNPQGK
    Newman          NKDELEVMFNTTVNSDTDVIKYGRLLVDKGAQSVIVSLGGDGAIYIDKEISIKAVNPQGK
    USA300_FPR3757  NKDELEVMFNTTVNSDTDVIKYGRLLVDKGAQSVIVSLGGDGAIYIDKEISIKAVNPQGK
                    ************************************************************

    COL             VVNTVGSGDSTVAGMVAGIASGLTIEKAFQQAVACGTATAFDEDLATRDAIEKIKSQVTI
    N315            VVNTVGSGDSTVAGMVAGIASGLTIEKAFQQAVACGTATAFDEDLATRDAIEKIKSQVTI
    NCTC8325        VVNTVGSGDSTVAGMVAGIASGLTIEKAFQQAVACGTATAFDEDLATRDAIEKIKSQVTI
    Newman          VVNTVGSGDSTVAGMVAGIASGLTIEKAFQQAVACGTATAFDEDLATRDAIEKIKSQVTI
    USA300_FPR3757  VVNTVGSGDSTVAGMVAGIASGLTIEKAFQQAVACGTATAFDEDLATRDAIEKIKSQVTI
                    ************************************************************

    COL             SVLDGE
    N315            SVLDGE
    NCTC8325        SVLDGE
    Newman          SVLDGE
    USA300_FPR3757  SVLDGE
                    ******