From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002587000
  • symbol?:
  • description?: HlyC/CorC family transporter

      descriptions from strain specific annotations:

    • HlyC/CorC family transporter
    • hemolysin
    • putative hemolysin
    • CBS domain-containing protein
    • CBS domain protein
    • CorC
    • Hemolysin-like protein containing CBS domains
    • Hemolysin-related protein s containing CBS domains
    • magnesium and cobalt efflux protein corC
    • transporter associated domain protein
  • strand?: +
  • coordinates?: 3099491..3100840
  • synteny block?: BlockID0018230
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0679
    08BA02176:
    C248_0786
    11819-97:
    MS7_0753
    71193:
    ST398NM01_0779
    ECT-R 2:
    ECTR2_653
    ED133:
    SAOV_0736
    ED98:
    SAAV_0664
    HO 5096 0412:
    SAEMRSA15_06280
    JH1:
    SaurJH1_0742
    JH9:
    SaurJH9_0726
    JKD6008:
    SAA6008_00718
    JKD6159:
    SAA6159_00657
    LGA251:
    SARLGA251_06350
    M013:
    M013TW_0688
    MRSA252:
    SAR0755
    MSHR1132:
    SAMSHR1132_06470
    MSSA476:
    SAS0667
    Mu3:
    SAHV_0699
    Mu50:
    SAV0702
    MW2:
    MW0664
    RF122:
    SAB0651
    ST398:
    SAPIG0779
    T0131:
    SAT0131_00772
    TCH60:
    HMPREF0772_12485
    TW20:
    SATW20_07770
    USA300_TCH1516:
    USA300HOU_0725
    VC40:
    SAVC_03145

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             METSTIISLIIFILLIALTTVFVGSEFALVKIRATRIEQLADEGNKPAKIVKKMIANLDY
    N315            METSTIISLIIFILLIALTTVFVGSEFALVKIRATRIEQLADEGNKPAKIVKKMIANLDY
    NCTC8325        METSTIISLIIFILLIALTTVFVGSEFALVKIRATRIEQLADEGNKPAKIVKKMIANLDY
    Newman          METSTIISLIIFILLIALTTVFVGSEFALVKIRATRIEQLADEGNKPAKIVKKMIANLDY
    USA300_FPR3757  METSTIISLIIFILLIALTTVFVGSEFALVKIRATRIEQLADEGNKPAKIVKKMIANLDY
                    ************************************************************

    COL             YLSACQLGITVTSLGLGWLGEPTFEKLLHPIFEAINLPTALTTTISFAVSFIIVTYLHVV
    N315            YLSACQLGITVTSLGLGWLGEPTFEKLLHPIFEAINLPTALTTTISFAVSFIIVTYLHVV
    NCTC8325        YLSACQLGITVTSLGLGWLGEPTFEKLLHPIFEAINLPTALTTTISFAVSFIIVTYLHVV
    Newman          YLSACQLGITVTSLGLGWLGEPTFEKLLHPIFEAINLPTALTTTISFAVSFIIVTYLHVV
    USA300_FPR3757  YLSACQLGITVTSLGLGWLGEPTFEKLLHPIFEAINLPTALTTTISFAVSFIIVTYLHVV
                    ************************************************************

    COL             LGELAPKSIAIQHTEKLALVYARPLFYFGNIMKPLIWLMNGSARVIIRMFGVNPDAQTDA
    N315            LGELAPKSIAIQHTEKLALVYARPLFYFGNIMKPLIWLMNGSARVIIRMFGVNPDAQTDA
    NCTC8325        LGELAPKSIAIQHTEKLALVYARPLFYFGNIMKPLIWLMNGSARVIIRMFGVNPDAQTDA
    Newman          LGELAPKSIAIQHTEKLALVYARPLFYFGNIMKPLIWLMNGSARVIIRMFGVNPDAQTDA
    USA300_FPR3757  LGELAPKSIAIQHTEKLALVYARPLFYFGNIMKPLIWLMNGSARVIIRMFGVNPDAQTDA
                    ************************************************************

    COL             MSEEEIKIIINNSYNGGEINQTELAYMQNIFSFDERHAKDIMVPRTQMITLNEPFNVDEL
    N315            MSEEEIKIIINNSYNGGEINQTELAYMQNIFSFDERHAKDIMVPRTQMITLNEPFNVDEL
    NCTC8325        MSEEEIKIIINNSYNGGEINQTELAYMQNIFSFDERHAKDIMVPRTQMITLNEPFNVDEL
    Newman          MSEEEIKIIINNSYNGGEINQTELAYMQNIFSFDERHAKDIMVPRTQMITLNEPFNVDEL
    USA300_FPR3757  MSEEEIKIIINNSYNGGEINQTELAYMQNIFSFDERHAKDIMVPRTQMITLNEPFNVDEL
                    ************************************************************

    COL             LETIKEHQFTRYPITDDGDKDHIKGFINVKEFLTEYASGKTIKIANYIHELPMISETTRI
    N315            LETIKEHQFTRYPITDDGDKDHIKGFINVKEFLTEYASGKTIKIANYIHELPMISETTRI
    NCTC8325        LETIKEHQFTRYPITDDGDKDHIKGFINVKEFLTEYASGKTIKIANYIHELPMISETTRI
    Newman          LETIKEHQFTRYPITDDGDKDHIKGFINVKEFLTEYASGKTIKIANYIHELPMISETTRI
    USA300_FPR3757  LETIKEHQFTRYPITDDGDKDHIKGFINVKEFLTEYASGKTIKIANYIHELPMISETTRI
                    ************************************************************

    COL             SDALIRMQREHVHMSLIIDEYGGTAGILTMEDILEEIVGEIRDEFDDDEVNDIVKIDNKT
    N315            SDALIRMQREHVHMSLIIDEYGGTAGILTMEDILEEIVGEIRDEFDDDEVNDIVKIDNKT
    NCTC8325        SDALIRMQREHVHMSLIIDEYGGTAGILTMEDILEEIVGEIRDEFDDDEVNDIVKIDNKT
    Newman          SDALIRMQREHVHMSLIIDEYGGTAGILTMEDILEEIVGEIRDEFDDDEVNDIVKIDNKT
    USA300_FPR3757  SDALIRMQREHVHMSLIIDEYGGTAGILTMEDILEEIVGEIRDEFDDDEVNDIVKIDNKT
                    ************************************************************

    COL             FQVNGRVLLDDLTEEFGIEFDDSEDIDTIGGWLQSRNTNLQKDDYVDTTYDRWVVSEIDN
    N315            FQVNGRVLLDDLTEEFGIEFDDSEDIDTIGGWLQSRNTNLQKDDYVDTTYDRWVVSEIDN
    NCTC8325        FQVNGRVLLDDLTEEFGIEFDDSEDIDTIGGWLQSRNTNLQKDDYVDTTYDRWVVSEIDN
    Newman          FQVNGRVLLDDLTEEFGIEFDDSEDIDTIGGWLQSRNTNLQKDDYVDTTYDRWVVSEIDN
    USA300_FPR3757  FQVNGRVLLDDLTEEFGIEFDDSEDIDTIGGWLQSRNTNLQKDDYVDTTYDRWVVSEIDN
                    ************************************************************

    COL             HQIIWVILNYEFNEARPTIGQSDEDEKSE
    N315            HQIIWVILNYEFNEARPTIGQSDEDEKSE
    NCTC8325        HQIIWVILNYEFNEARPTIGQSDEDEKSE
    Newman          HQIIWVILNYEFNEARPTIGQSDEDEKSE
    USA300_FPR3757  HQIIWVILNYEFNEARPTIGQSDEDEKSE
                    *****************************