From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003015000
  • symbol?:
  • description?: CBS domain protein

      descriptions from strain specific annotations:

    • CBS domain protein
    • Hemolysin-like protein containing CBS domains
    • CBS domain-containing protein
    • putative Mg2+ and Co2+ transporter, CorB
    • CorC
  • strand?: +
  • coordinates?: 3408857..3409897
  • synteny block?: BlockID0021230
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0874
    08BA02176:
    C248_0918
    11819-97:
    MS7_0875
    71193:
    ST398NM01_0903
    ECT-R 2:
    ECTR2_775
    ED133:
    SAOV_0866
    ED98:
    SAAV_0880
    HO 5096 0412:
    SAEMRSA15_07500
    JH1:
    SaurJH1_0936
    JH9:
    SaurJH9_0918
    JKD6008:
    SAA6008_00871
    JKD6159:
    SAA6159_00779
    LGA251:
    SARLGA251_08380
    M013:
    MRSA252:
    SAR0882
    MSHR1132:
    SAMSHR1132_07720
    MSSA476:
    SAS0790
    Mu3:
    SAHV_0914
    Mu50:
    SAV0919
    MW2:
    MW0802
    RF122:
    SAB0786
    ST398:
    SAPIG0903
    T0131:
    SAT0131_00949
    TCH60:
    HMPREF0772_12327
    TW20:
    SATW20_09200
    USA300_TCH1516:
    USA300HOU_0878
    VC40:
    SAVC_03775

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIIAIIILIFISFFFSGSETALTAANKAKFKTEADKGDKKAKGIVKLLEKPSEFITTILI
    N315            MIIAIIILIFISFFFSGSETALTAANKTKFKTEADKGDKKAKGIVKLLEKPSEFITTILI
    NCTC8325        MIIAIIILIFISFFFSGSETALTAANKTKFKTEADKGDKKAKGIVKLLEKPSEFITTILI
    Newman          MIIAIIILIFISFFFSGSETALTAANKTKFKTEADKGDKKAKGIVKLLEKPSEFITTILI
    USA300_FPR3757  MIIAIIILIFISFFFSGSETALTAANKTKFKTEADKGDKKAKGIVKLLEKPSEFITTILI
                    ***************************:********************************

    COL             GNNVANILLPTLVTIMALRWGISVGIASAVLTVVIILISEVIPKSVAATFPDKITRLVYP
    N315            GNNVANILLPTLVTIMALRWGISVGIASAVLTVVIILISEVIPKSVAATFPDKITRLVYP
    NCTC8325        GNNVANILLPTLVTIMALRWGISVGIASAVLTVVIILISEVIPKSVAATFPDKITRLVYP
    Newman          GNNVANILLPTLVTIMALRWGISVGIASAVLTVVIILISEVIPKSVAATFPDKITRLVYP
    USA300_FPR3757  GNNVANILLPTLVTIMALRWGISVGIASAVLTVVIILISEVIPKSVAATFPDKITRLVYP
                    ************************************************************

    COL             IINICVIVFRPITLLLNKLTDSINRSLSKGQPQEHQFSKEEFKTMLAIAGHEGALNEIET
    N315            IINICVIVFRPITLLLNKLTDSINRSLSKGQPQEHQFSKEEFKTMLAIAGHEGALNEIET
    NCTC8325        IINICVIVFRPITLLLNKLTDSINRSLSKGQPQEHQFSKEEFKTMLAIAGHEGALNEIET
    Newman          IINICVIVFRPITLLLNKLTDSINRSLSKGQPQEHQFSKEEFKTMLAIAGHEGALNEIET
    USA300_FPR3757  IINICVIVFRPITLLLNKLTDSINRSLSKGQPQEHQFSKEEFKTMLAIAGHEGALNEIET
                    ************************************************************

    COL             SRLEGVINFENLKVKDVDTTPRINVTAFASNATYEEVYETVMNKPYTRYPVYEGDIDNII
    N315            SRLEGVINFENLKVKDVDTTPRINVTAFASNATYEEVYETVMNKPYTRYPVYEGDIDNII
    NCTC8325        SRLEGVINFENLKVKDVDTTPRINVTAFASNATYEEVYETVMNKPYTRYPVYEGDIDNII
    Newman          SRLEGVINFENLKVKDVDTTPRINVTAFASNATYEEVYETVMNKPYTRYPVYEGDIDNII
    USA300_FPR3757  SRLEGVINFENLKVKDVDTTPRINVTAFASNATYEEVYETVMNKPYTRYPVYEGDIDNII
                    ************************************************************

    COL             GVFHSKYLLAWSNKKENQITNYSAKPLFVNEHNKAEWVLRKMTISRKHLAIVLDEFGGTE
    N315            GVFHSKYLLAWSNKKEDQITNYSAKPLFVNEHNKAEWVLRKMTISRKHLAIVLDEFGGTE
    NCTC8325        GVFHSKYLLAWSNKKENQITNYSAKPLFVNEHNKAEWVLRKMTISRKHLAIVLDEFGGTE
    Newman          GVFHSKYLLAWSNKKENQITNYSAKPLFVNEHNKAEWVLRKMTISRKHLAIVLDEFGGTE
    USA300_FPR3757  GVFHSKYLLAWSNKKENQITNYSAKPLFVNEHNKAEWVLRKMTISRKHLAIVLDEFGGTE
                    ****************:*******************************************

    COL             AIVSHEDLIEELLGMEIEDEMDKKEKEKLSQQQIQFQQRKNRNVSI
    N315            AIVSHEDLIEELLGMEIEDEMDKKEKEKLSQQQIQFQQRKNRNVSI
    NCTC8325        AIVSHEDLIEELLGMEIEDEMDKKEKEKLSQQQIQFQQRKNRNVSI
    Newman          AIVSHEDLIEELLGMEIEDEMDKKEKEKLSQQQIQFQQRKNRNVSI
    USA300_FPR3757  AIVSHEDLIEELLGMEIEDEMDKKEKEKLSQQQIQFQQRKNRNVSI
                    **********************************************