From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002593000
  • symbol?: saeQ
  • description?: DoxX family protein

      descriptions from strain specific annotations:

    • DoxX family protein
    • DoxX subfamily, putative
  • strand?: -
  • coordinates?: 3104834..3105307
  • synteny block?: BlockID0018290
  • occurrence?: in 84% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_0791
    11819-97:
    MS7_0758
    71193:
    ST398NM01_0784
    ECT-R 2:
    ECTR2_658
    ED133:
    SAOV_0741c
    ED98:
    SAAV_0669
    HO 5096 0412:
    SAEMRSA15_06330
    JH1:
    SaurJH1_0747
    JH9:
    SaurJH9_0731
    JKD6008:
    SAA6008_00723
    JKD6159:
    SAA6159_00662
    LGA251:
    SARLGA251_06400 (saeQ)
    M013:
    M013TW_0693
    MRSA252:
    SAR0760
    MSHR1132:
    SAMSHR1132_06520
    MSSA476:
    SAS0672
    Mu3:
    Mu50:
    MW2:
    RF122:
    SAB0656c
    ST398:
    SAPIG0784
    T0131:
    SAT0131_00777
    TCH60:
    HMPREF0772_12480
    TW20:
    SATW20_07820 (saeQ)
    USA300_TCH1516:
    USA300HOU_0730
    VC40:
    SAVC_03170

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKLLLLVTFIIRVGSGIVMLMQGYEKLTGGFTLKGLVPVIANNTDSPEWYKWFFANIVA
    NCTC8325        MNKLLLLVTFIIRVGSGIVMLMQGYEKLTGGFTLKGLVPVIANNTDSPEWYKWFFANIVA
    Newman          MNKLLLLVTFIIRVGSGIVMLMQGYEKLTGGFTLKGLVPVIANNTDSPEWYKWFFANIVA
    USA300_FPR3757  MNKLLLLVTFIIRVGSGIVMLMQGYEKLTGGFTLKGLVPVIANNTDSPEWYKWFFANIVA
                    ************************************************************

    COL             HTTSLFDIVVPLGEIAIGLGLIFGVFAYAASFFGAFVMINYILADMIFTYPLQLTFFILL
    NCTC8325        HTTSLFDIVVPLGEIAIGLGLIFGVFAYAASFFGAFVMINYILADMIFTYPLQLTFFILL
    Newman          HTTSLFDIVVPLGEIAIGLGLIFGVFAYAASFFGAFVMINYILADMIFTYPLQLTFFILL
    USA300_FPR3757  HTTSLFDIVVPLGEIAIGLGLIFGVFAYAASFFGAFVMINYILADMIFTYPLQLTFFILL
                    ************************************************************

    COL             LMSHSLLKQISLKEIINYFRGRKNRGEKIDDPLTDRG
    NCTC8325        LMSHSLLKQISLKEIINYFRGRKNRGEKIDDPLTDRG
    Newman          LMSHSLLKQISLKEIINYFRGRKNRGEKIDDPLTDRG
    USA300_FPR3757  LMSHSLLKQISLKEIINYFRGRKNRGEKIDDPLTDRG
                    *************************************