From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002601000
  • symbol?:
  • description?: aminodeoxychorismate lyase

      descriptions from strain specific annotations:

    • aminodeoxychorismate lyase
    • chorismate binding protein
    • 4-amino-4-deoxychorismate lyase
    • branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase-like protein
    • putative para-aminobenzoate synthetasecomponent
    • Aminodeoxychorismate lyase PabAc
    • aminotransferase class IV family protein
    • chorismate binding enzyme
    • para-aminobenzoate synthase component I
    • para-aminobenzoate synthetase component
    • probable anthranilate/para-aminobenzoate synthase component I
    • putative anthranilate/para-aminobenzoate synthase component I
  • strand?: +
  • coordinates?: 3111027..3111639
  • synteny block?: BlockID0018370
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0684 (pabC)
    USA300_FPR3757:
    04-02981:
    SA2981_0692
    08BA02176:
    C248_0799
    11819-97:
    MS7_0766
    71193:
    ST398NM01_0792
    ECT-R 2:
    ECTR2_666
    ED133:
    SAOV_0749
    ED98:
    SAAV_0677
    HO 5096 0412:
    SAEMRSA15_06410
    JH1:
    SaurJH1_0755
    JH9:
    SaurJH9_0739
    JKD6008:
    SAA6008_00731 (pabC)
    JKD6159:
    SAA6159_00670 (pabC)
    LGA251:
    SARLGA251_06480
    M013:
    M013TW_0701
    MRSA252:
    SAR0768
    MSHR1132:
    SAMSHR1132_06600
    MSSA476:
    SAS0680
    Mu3:
    SAHV_0712
    Mu50:
    SAV0715
    MW2:
    MW0677
    RF122:
    SAB0664
    ST398:
    SAPIG0792
    T0131:
    SAT0131_00785
    TCH60:
    HMPREF0772_12472
    TW20:
    SATW20_07900
    USA300_TCH1516:
    USA300HOU_0738 (pabC)
    VC40:
    SAVC_03210

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MQLFETMKIDNGHIPRLTYHTNRIKCSSERLNFKFDEHAWRNELNDVTTKYHSGQYRLKI
    NCTC8325        MQLFETMKIDNGHIPRLTYHTNRIKCSSERLNFKFDEHAWRNELNDVTTKYHSGQYRLKI
    Newman          MQLFETMKIDNGHIPRLTYHTNRIKCSSERLNFKFDEHAWRNELNDVTTKYHSGQYRLKI
    USA300_FPR3757  MQLFETMKIDNGHIPRLTYHTNRIKCSSERLNFKFDEHAWRNELNDVTTKYHSGQYRLKI
                    ************************************************************

    N315            VLNAESKFETIVSPLPEKSSFTAKFQVLPKVVNPTFIKNKTTERKHLAHNHETDLILLTS
    NCTC8325        VLNAESKFETIVSPLPEKSSFTAKFQVLPKVVNPTFIKNKTTERKHLAHNHETDLILLTS
    Newman          VLNAESKFETIVSPLPEKSSFTAKFQVLPKVVNPTFIKNKTTERKHLAHNHETDLILLTS
    USA300_FPR3757  VLNAESKFETIVSPLPEKSSFTAKFQVLPKVVNPTFIKNKTTERKHLAHNHETDLILLTS
                    ************************************************************

    N315            EDGKVLEFDIGNIVIEEDGKWYTPSYKDDFLKGCMRDYLIDSDKLVEKDFNKNELIYKYH
    NCTC8325        EDGKVLEFDIGNIVIEEDGKWYTPSYKDDFLKGCMRDYLIDSDKLVEKDFNKNELIYKYH
    Newman          EDGKVLEFDIGNIVIEEDGKWYTPSYKDDFLKGCMRDYLIDSDKLVEKDFNKNELIYKYH
    USA300_FPR3757  EDGKVLEFDIGNIVIEEDGKWYTPSYKDDFLKGCMRDYLIDSDKLVEKDFNKNELIYKYH
                    ************************************************************

    N315            NNEIRLFLINSLREVADVHLCL
    NCTC8325        NNEIRLFLINSLREVADVHLCL
    Newman          NNEIRLFLINSLREVADVHLCL
    USA300_FPR3757  NNEIRLFLINSLREVADVHLCL
                    **********************