From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002627000
  • symbol?:
  • description?: transporter

      descriptions from strain specific annotations:

    • transporter
    • integral membrane domain-containing protein
    • Integral membrane domain protein
    • integral membrane protein
    • DMT superfamily drug/metabolite transporter
    • triose-phosphate Transporter family protein
    • drug/metabolite exporter family transporter
  • strand?: -
  • coordinates?: 3131212..3131949
  • synteny block?: BlockID0018620
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0707
    08BA02176:
    C248_0816
    11819-97:
    MS7_0780
    71193:
    ST398NM01_0806
    ECT-R 2:
    ECTR2_679
    ED133:
    SAOV_0764c
    ED98:
    SAAV_0690
    HO 5096 0412:
    SAEMRSA15_06550
    JH1:
    SaurJH1_0770
    JH9:
    SaurJH9_0752
    JKD6008:
    SAA6008_00744
    JKD6159:
    SAA6159_00684
    LGA251:
    SARLGA251_06620
    M013:
    M013TW_0715
    MRSA252:
    SAR0783
    MSHR1132:
    SAMSHR1132_06740
    MSSA476:
    SAS0694
    Mu3:
    SAHV_0726
    Mu50:
    SAV0729
    MW2:
    MW0691
    RF122:
    SAB0679c
    ST398:
    SAPIG0806
    T0131:
    SAT0131_00799
    TCH60:
    HMPREF0772_12456
    TW20:
    SATW20_08040
    USA300_TCH1516:
    USA300HOU_0753
    VC40:
    SAVC_03280

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNPKVKGIIAILISAIGFSFMSVFFRLAGDLPVFQKSLARNLVAMFIPLFFIYKYHQPMF
    N315            MNPKVKGIIAILISAIGFSFMSVFFRLAGDLPVFQKSLARNLVAMFIPLFFLYKYHQPMF
    NCTC8325        --------------------------------------------MFIPLFFIYKYHQPMF
    Newman          MNPKVKGIIAILISAIGFSFMSVFFRLAGDLPVFQKSLARNLVAMFIPLFFIYKYHQPMF
    USA300_FPR3757  MNPKVKGIIAILISAIGFSFMSVFFRLAGDLPVFQKSLARNLVAMFIPLFFIYKYHQPMF
                                                                *******:********

    COL             GRLSSQPLLITRSTLGLIGVLLNIYAIDHMVLSDADSLMKLNPFWTILLSIVFLHEKVRK
    N315            GRLSSQPLLITRSTLGLIGVLLNIYAIDHMVLSDADSLMKLNPFWTILLSIVFLHEKVRK
    NCTC8325        GRLSSQPLLITRSTLGLIGVLLNIYAIDHMVLSDADSLMKLNPFWTILLSIVFLHEKVRK
    Newman          GRLSSQPLLITRSTLGLIGVLLNIYAIDHMVLSDADSLMKLNPFWTILLSIVFLHEKVRK
    USA300_FPR3757  GRLSSQPLLITRSTLGLIGVLLNIYAIDHMVLSDADSLMKLNPFWTILLSIVFLHEKVRK
                    ************************************************************

    COL             YQITAMIIAILGMLLIVKPEFSSSMIPSLAGLFSGIFAASAYTCVRALSTREAPYTIVFY
    N315            YQITAMIIAILGMLLIVKPEFSSSMIPSLAGLFSGIFAASAYTCVRALSSREAPYTIVFY
    NCTC8325        YQITAMIIAILGMLLIVKPEFSSSMIPSLAGLFSGIFAASAYTCVRALSTREAPYTIVFY
    Newman          YQITAMIIAILGMLLIVKPEFSSSMIPSLAGLFSGIFAASAYTCVRALSTREAPYTIVFY
    USA300_FPR3757  YQITAMIIAILGMLLIVKPEFSSSMIPSLAGLFSGIFAASAYTCVRALSTREAPYTIVFY
                    *************************************************:**********

    COL             FSLFSVIVLIPFTAYTYEPMSQMQILYLLGAGLAAAVGQIGVTLAYSFAAAKDISIFTYA
    N315            FSLFSVIVLIPFTAYTYEPMSQMQILYLLGAGLAAAVGQIGVTLAYSFAAAKDISIFTYA
    NCTC8325        FSLFSVIVLIPFTAYTYEPMSQMQILYLLGAGLAAAVGQIGVTLAYSFAAAKDISIFTYA
    Newman          FSLFSVIVLIPFTAYTYEPMSQMQILYLLGAGLAAAVGQIGVTLAYSFAAAKDISIFTYA
    USA300_FPR3757  FSLFSVIVLIPFTAYTYEPMSQMQILYLLGAGLAAAVGQIGVTLAYSFAAAKDISIFTYA
                    ************************************************************

    COL             SIIFTAILGFILFGESPDFYATLGYVVIIGASYYMFEKARRDAKIIKK
    N315            SIIFTAILGFVLFGESPDFYATLGYVVIIGASYYMFEKARRDAKIIKK
    NCTC8325        SIIFTAILGFILFGESPDFYATLGYVVIIGASYYMFEKARRDAKIIKK
    Newman          SIIFTAILGFILFGESPDFYATLGYVVIIGASYYMFEKARRDAKIIKK
    USA300_FPR3757  SIIFTAILGFILFGESPDFYATLGYVVIIGASYYMFEKARRDAKIIKK
                    **********:*************************************