From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002647000
  • symbol?:
  • description?: ytxJ

      descriptions from strain specific annotations:

    • ytxJ
    • YtxJ like protein
  • strand?: +
  • coordinates?: 3146044..3146373
  • synteny block?: BlockID0018820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0719
    08BA02176:
    C248_0828
    11819-97:
    MS7_0791
    71193:
    ST398NM01_0817
    ECT-R 2:
    ECTR2_691
    ED133:
    SAOV_0778
    ED98:
    SAAV_0703
    HO 5096 0412:
    SAEMRSA15_06670
    JH1:
    SaurJH1_0782
    JH9:
    SaurJH9_0765
    JKD6008:
    SAA6008_00756
    JKD6159:
    SAA6159_00696
    LGA251:
    SARLGA251_06740
    M013:
    M013TW_0726
    MRSA252:
    SAR0795
    MSHR1132:
    SAMSHR1132_06860
    MSSA476:
    SAS0706
    Mu3:
    SAHV_0738
    Mu50:
    SAV0741
    MW2:
    MW0703
    RF122:
    SAB0693
    ST398:
    SAPIG0817
    T0131:
    SAT0131_00813
    TCH60:
    HMPREF0772_12442
    TW20:
    SATW20_08160
    USA300_TCH1516:
    USA300HOU_0768
    VC40:
    SAVC_03340

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAIKLSSIDQFEQVIEENKYVFVLKHSETCPISANAYDQFNKFLYERDMDGYYLIVQQER
    N315            MAIKLSSIDQFEQVIEENKYVFVLKHSETCPISANAYDQFNKFLYERDMDGYYLIVQQER
    NCTC8325        MAIKLSSIDQFEQVIEENKYVFVLKHSETCPISANAYDQFNKFLYERDMDGYYLIVQQER
    Newman          MAIKLSSIDQFEQVIEENKYVFVLKHSETCPISANAYDQFNKFLYERDMDGYYLIVQQER
    USA300_FPR3757  MAIKLSSIDQFEQVIEENKYVFVLKHSETCPISANAYDQFNKFLYERDMDGYYLIVQQER
                    ************************************************************

    COL             DLSDYIAKKTNVKHESPQAFYFVNGEMVWNRDHGDINVSSLAQAEE
    N315            DLSDYIAKKTNVKHESPQAFYFVNGEMVWNRDHGDINVSSLAQAEE
    NCTC8325        DLSDYIAKKTNVKHESPQAFYFVNGEMVWNRDHGDINVSSLAQAEE
    Newman          DLSDYIAKKTNVKHESPQAFYFVNGEMVWNRDHGDINVSSLAQAEE
    USA300_FPR3757  DLSDYIAKKTNVKHESPQAFYFVNGEMVWNRDHGDINVSSLAQAEE
                    **********************************************