From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002654000
  • symbol?: tagO
  • description?: undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase

      descriptions from strain specific annotations:

    • undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase
    • glycosyl transferase, group 4 family protein
    • lipophilic protein affecting lysis rate and methicillin resistance level
    • lipophilic regulator protein
    • putative glycosyltransferase
    • Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase
    • glycoside hydrolase family protein
    • glycosyl transferase 4 family protein
    • glycosyl transferase family protein
    • lipophilic protein affecting lysis rate and methicillin resistance level protein
    • probable undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphatetransferase (UDP-GlcNAc:undecaprenyl-P GlcNAc 1-Ptransferase)
    • putative undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphatetransferase (UDP-GlcNAc:undecaprenyl-P GlcNAc 1-Ptransferase)
    • UDP-N-acetylglucosamine:undecaprenyl-P N-acetylglucosaminyl 1-P transferase
    • Undecaprenyl-phosphate alpha-N-acetylglucosaminephosphotransferase
  • strand?: +
  • coordinates?: 3152381..3153436
  • synteny block?: BlockID0018890
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0702 (llm)
    NCTC8325:
    Newman:
    NWMN_0716 (llm)
    USA300_FPR3757:
    04-02981:
    SA2981_0725 (llm)
    08BA02176:
    C248_0834
    11819-97:
    MS7_0797
    71193:
    ST398NM01_0823
    ECT-R 2:
    ECTR2_697
    ED133:
    SAOV_0784
    ED98:
    SAAV_0709
    HO 5096 0412:
    SAEMRSA15_06730
    JH1:
    SaurJH1_0788
    JH9:
    SaurJH9_0771
    JKD6008:
    SAA6008_00762
    JKD6159:
    SAA6159_00702
    LGA251:
    SARLGA251_06800 (tarO)
    M013:
    M013TW_0734
    MRSA252:
    SAR0801
    MSHR1132:
    SAMSHR1132_06920
    MSSA476:
    SAS0712
    Mu3:
    SAHV_0744 (llm)
    Mu50:
    SAV0747 (llm)
    MW2:
    MW0709 (llm)
    RF122:
    SAB0699
    ST398:
    SAPIG0823
    T0131:
    SAT0131_00819
    TCH60:
    HMPREF0772_12436 (tagO)
    TW20:
    SATW20_08220 (tarO)
    USA300_TCH1516:
    USA300HOU_0774
    VC40:
    SAVC_03370

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVTLLLVAVTMIVSLTITPIVIAISKRLNLVDKPNFRKVHTKPISVMGGTVILFSFLIGI
    N315            MVTLLLVAVTMIVSLTITPIVIAISKRLNLVDKPNFRKVHTKPISVMGGTVILFSFLIGI
    NCTC8325        MVTLLLVAVTMIVSLTITPIVIAISKRLNLVDKPNFRKVHTKPISVMGGTVILFSFLIGI
    Newman          MVTLLLVAVTMIVSLTITPIVIAISKRLNLVDKPNFRKVHTKPISVMGGTVILFSFLIGI
    USA300_FPR3757  MVTLLLVAVTMIVSLTITPIVIAISKRLNLVDKPNFRKVHTKPISVMGGTVILFSFLIGI
                    ************************************************************

    COL             WIGHPIETEIKPLIIGAIIMYVLGLVDDIYDLKPYIKLAGQIAAALVVAFYGVTIDFISL
    N315            WIGHPIETEIKPLIIGAIIMYVLGLVDDIYDLKPYIKLAGQIAAALVVAFYGVTIDFISL
    NCTC8325        WIGHPIETEIKPLIIGAIIMYVLGLVDDIYDLKPYIKLAGQIAAALVVAFYGVTIDFISL
    Newman          WIGHPIETEIKPLIIGAIIMYVLGLVDDIYDLKPYIKLAGQIAAALVVAFYGVTIDFISL
    USA300_FPR3757  WIGHPIETEIKPLIIGAIIMYVLGLVDDIYDLKPYIKLAGQIAAALVVAFYGVTIDFISL
                    ************************************************************

    COL             PMGTTIHFGFLSIPITVIWIVAITNAINLIDGLDGLASGVSAIGLITIGFIAILQANIFI
    N315            PMGTTIHFGFLSIPITVIWIVAITNAINLIDGLDGLASGVSAIGLITIGFIAILQANIFI
    NCTC8325        PMGTTIHFGFLSIPITVIWIVAITNAINLIDGLDGLASGVSAIGLITIGFIAILQANIFI
    Newman          PMGTTIHFGFLSIPITVIWIVAITNAINLIDGLDGLASGVSAIGLITIGFIAILQANIFI
    USA300_FPR3757  PMGTTIHFGFLSIPITVIWIVAITNAINLIDGLDGLASGVSAIGLITIGFIAILQANIFI
                    ************************************************************

    COL             TMICCVLLGSLIGFLFYNFHPAKIFLGDSGALMIGFIIGFLSLLGFKNITIIALFFPIVI
    N315            TMICCVLLGSLIGFLFYNFHPAKIFLGDSGALMIGFIIGFLSLLGFKNITIIALFFPIVI
    NCTC8325        TMICCVLLGSLIGFLFYNFHPAKIFLGDSGALMIGFIIGFLSLLGFKNITIIALFFPIVI
    Newman          TMICCVLLGSLIGFLFYNFHPAKIFLGDSGALMIGFIIGFLSLLGFKNITIIALFFPIVI
    USA300_FPR3757  TMICCVLLGSLIGFLFYNFHPAKIFLGDSGALMIGFIIGFLSLLGFKNITIIALFFPIVI
                    ************************************************************

    COL             LAVPFIDTLFAMIRRVKKGQHIMQADKSHLHHKLLALGYTHRQTVLLIYSISILFSLSSI
    N315            LAVPFIDTLFAMIRRVKKGQHIMQADKSHLHHKLLALGYTHRQTVLLIYSISILFSLSSI
    NCTC8325        LAVPFIDTLFAMIRRVKKGQHIMQADKSHLHHKLLALGYTHRQTVLLIYSISILFSLSSI
    Newman          LAVPFIDTLFAMIRRVKKGQHIMQADKSHLHHKLLALGYTHRQTVLLIYSISILFSLSSI
    USA300_FPR3757  LAVPFIDTLFAMIRRVKKGQHIMQADKSHLHHKLLALGYTHRQTVLLIYSISILFSLSSI
                    ************************************************************

    COL             ILYVSPPLGVVLMFVLIIFSIELIVEFTGLIDNNYRPILNLISRKSSHKEE
    N315            ILYVSPPLGVVLMFVLIIFSIELIVEFTGLIDNNYRPILNLISRKSSHKED
    NCTC8325        ILYVSPPLGVVLMFVLIIFSIELIVEFTGLIDNNYRPILNLISRKSSHKEE
    Newman          ILYVSPPLGVVLMFVLIIFSIELIVEFTGLIDNNYRPILNLISRKSSHKEE
    USA300_FPR3757  ILYVSPPLGVVLMFVLIIFSIELIVEFTGLIDNNYRPILNLISRKSSHKEE
                    **************************************************: