From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002655000
  • symbol?:
  • description?: YvyE protein
  • strand?: -
  • coordinates?: 3153697..3154152
  • synteny block?: BlockID0018900
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0726
    08BA02176:
    C248_0835
    11819-97:
    MS7_0798
    71193:
    ST398NM01_0824
    ECT-R 2:
    ECTR2_698
    ED133:
    SAOV_0785c
    ED98:
    SAAV_0710
    HO 5096 0412:
    SAEMRSA15_06740
    JH1:
    SaurJH1_0789
    JH9:
    SaurJH9_0772
    JKD6008:
    SAA6008_00763
    JKD6159:
    SAA6159_00703
    LGA251:
    SARLGA251_06810
    M013:
    M013TW_0735
    MRSA252:
    SAR0802
    MSHR1132:
    SAMSHR1132_06930
    MSSA476:
    SAS0713
    Mu3:
    SAHV_0745
    Mu50:
    SAV0748
    MW2:
    MW0710
    RF122:
    SAB0700c
    ST398:
    SAPIG0824
    T0131:
    SAT0131_00820
    TCH60:
    HMPREF0772_12435
    TW20:
    SATW20_08230
    USA300_TCH1516:
    USA300HOU_0775
    VC40:
    SAVC_03375

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTQNIITVKKEHIIENVISKSRFIAHIKPVQNEDEAKAFIAAIKKEHKDATHNCSAYTIG
    N315            MTQNIITVKKEHIIENVISKSRFIAHIKPVQNEDEAKAFIAAIKKEHKDATHNCSAYTIG
    NCTC8325        MTQNIITVKKEHIIENVISKSRFIAHIKPVQNEDEAKAFIAAIKKEHKDATHNCSAYTIG
    Newman          MTQNIITVKKEHIIENVISKSRFIAHIKPVQNEDEAKAFIAAIKKEHKDATHNCSAYTIG
    USA300_FPR3757  MTQNIITVKKEHIIENVISKSRFIAHIKPVQNEDEAKAFIAAIKKEHKDATHNCSAYTIG
                    ************************************************************

    COL             PEMNIQKANDDGEPTGTAGVPMLDILKKLDVHNACVVVTRYFGGIKLGGGGLIRAYSGAV
    N315            PEMNIQKANDDGEPTGTAGVPMLDILKKLDVHNACVVVTRYFGGIKLGGGGLIRAYSGAV
    NCTC8325        PEMNIQKANDDGEPTGTAGVPMLDILKKLDVHNACVVVTRYFGGIKLGGGGLIRAYSGAV
    Newman          PEMNIQKANDDGEPTGTAGVPMLDILKKLDVHNACVVVTRYFGGIKLGGGGLIRAYSGAV
    USA300_FPR3757  PEMNIQKANDDGEPTGTAGVPMLDILKKLDVHNACVVVTRYFGGIKLGGGGLIRAYSGAV
                    ************************************************************

    COL             RDVIYDIGRVELREAVPCIVTLNYDQTGKFEYELASTHFMLRNQTYTDKVSYYIDVVKSD
    N315            RDVIYDVGRVELREAVPCIVTLNYDQTGKFEYELASTHFMLRNQTYTDKVSYYIDVVKSD
    NCTC8325        RDVIYDIGRVELREAVPCIVTLNYDQTGKFEYELASTHFMLRNQTYTDKVSYYIDVVKSD
    Newman          RDVIYDIGRVELREAVPCIVTLNYDQTGKFEYELASTHFMLRNQTYTDKVSYYIDVVKSD
    USA300_FPR3757  RDVIYDIGRVELREAVPCIVTLNYDQTGKFEYELASTHFMLRNQTYTDKVSYYIDVVKSD
                    ******:*****************************************************

    COL             YEAFINFLNQMTAGNFDLTEETPKQLPFDIPTE
    N315            YEAFINFLNQMTAGNFDLTEETPKQLPFDIPTE
    NCTC8325        YEAFINFLNQMTAGNFDLTEETPKQLPFDIPTE
    Newman          YEAFINFLNQMTAGNFDLTEETPKQLPFDIPTE
    USA300_FPR3757  YEAFINFLNQMTAGNFDLTEETPKQLPFDIPTE
                    *********************************