From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002660000
  • symbol?: comFC
  • description?: ComF operon protein C

      descriptions from strain specific annotations:

    • ComF operon protein C
    • competence protein F
    • superfamily II DNA/RNA helicase ComFC
    • putative amidophosphoribosyltransferase, ComFC
    • phosphoribosyl transferase domain protein
    • late competence operon protein FC
    • ComF operon protein 3
  • strand?: +
  • coordinates?: 3157035..3157712
  • synteny block?: BlockID0018950
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0729
    08BA02176:
    C248_0838
    11819-97:
    MS7_0801
    71193:
    ST398NM01_0827
    ECT-R 2:
    ECTR2_701
    ED133:
    SAOV_0788
    ED98:
    SAAV_0713
    HO 5096 0412:
    SAEMRSA15_06770
    JH1:
    SaurJH1_0792
    JH9:
    SaurJH9_0775
    JKD6008:
    SAA6008_00766 (comFC)
    JKD6159:
    SAA6159_00706 (comFC)
    LGA251:
    SARLGA251_06840
    M013:
    M013TW_0738
    MRSA252:
    SAR0805
    MSHR1132:
    SAMSHR1132_06960
    MSSA476:
    SAS0716
    Mu3:
    SAHV_0748
    Mu50:
    SAV0751
    MW2:
    MW0713
    RF122:
    SAB0703 (comFC)
    ST398:
    SAPIG0827
    T0131:
    SAT0131_00823
    TCH60:
    HMPREF0772_12431 (comF)
    TW20:
    SATW20_08260
    USA300_TCH1516:
    USA300HOU_0778
    VC40:
    SAVC_03390

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNCLSCGAKLYENITIYNLFKKPNRLCDRCKENWDNIKLDIKARRCSRCLKHLNQDEAY
    N315            MNNCLSCGAKLYENITIYNLFKKPNRLCDRCKENWDNIKLDIKARRCSRCLKHLNQDEAY
    NCTC8325        MNNCLSCGAKLYENITIYNLFKKPNRLCDRCKENWDNIKLDIKARRCSRCLKHLNQDEAY
    Newman          MNNCLSCGAKLYENITIYNLFKKPNRLCDRCKENWDNIKLDIKARRCSRCLKHLNQDEAY
    USA300_FPR3757  MNNCLSCGAKLYENITIYNLFKKPNRLCDRCKENWDNIKLDIKARRCSRCLKHLNQDEAY
                    ************************************************************

    COL             CLDCKFLSAHFNLMEQLYCQFQYDGLMKEMIHQYKFLKDYYLCELLAHLIEIPQTSYDYI
    N315            CLDCKFLSAHFNLMEQLYCQFQYDGLMKEMIHQYKFLKDYYLCELLAHLIEIPQTSYDYI
    NCTC8325        CLDCKFLSAHFNLMEQLYCQFQYDGLMKEMIHQYKFLKDYYLCELLAHLIEIPQTSYDYI
    Newman          CLDCKFLSAHFNLMEQLYCQFQYDGLMKEMIHQYKFLKDYYLCELLAHLIEIPQTSYDYI
    USA300_FPR3757  CLDCKFLSAHFNLMEQLYCQFQYDGLMKEMIHQYKFLKDYYLCELLAHLIEIPQTSYDYI
                    ************************************************************

    COL             VPIPSSPAHDLSRTFNPVEAVLKAKGIRFDKILKMSNRPKQSHLTKKERLADENPFIIDT
    N315            VPIPSSPAHDLSRTFNPVEAVLKAKGIRFDKILKMSNRPKQSHLTKKERLADENPFIIDT
    NCTC8325        VPIPSSPAHDLSRTFNPVEAVLKAKGIRFDKILKMSNRPKQSHLTKKERLADENPFIIDT
    Newman          VPIPSSPAHDLSRTFNPVEAVLKAKGIRFDKILKMSNRPKQSHLTKKERLADENPFIIDT
    USA300_FPR3757  VPIPSSPAHDLSRTFNPVEAVLKAKGIRFDKILKMSNRPKQSHLTKKERLADENPFIIDT
                    ************************************************************

    COL             ELDLNGKEILLVDDIYTTGLTIHRAGCKLYAKNIRKFKVFAFAR
    N315            ELDLNGKEILLVDDIYTTGLTIHRAGCKLYAKNIRKFKVFAFAR
    NCTC8325        ELDLNGKEILLVDDIYTTGLTIHRAGCKLYAKNIRKFKVFAFAR
    Newman          ELDLNGKEILLVDDIYTTGLTIHRAGCKLYAKNIRKFKVFAFAR
    USA300_FPR3757  ELDLNGKEILLVDDIYTTGLTIHRAGCKLYAKNIRKFKVFAFAR
                    ********************************************