From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002689000
  • symbol?:
  • description?: ATP-binding protein UPF0042, contains P-loop

      descriptions from strain specific annotations:

    • ATP-binding protein UPF0042, contains P-loop
    • P-loop ATPase family protein
    • glmZ(sRNA)-inactivating NTPase
    • putative P-loop ATPase/kinase
  • strand?: +
  • coordinates?: 3183787..3184698
  • synteny block?: BlockID0019210
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0743
    08BA02176:
    C248_0853
    11819-97:
    MS7_0815
    71193:
    ST398NM01_0842
    ECT-R 2:
    ECTR2_715
    ED133:
    SAOV_0803
    ED98:
    SAAV_0729
    HO 5096 0412:
    SAEMRSA15_06910
    JH1:
    SaurJH1_0806
    JH9:
    SaurJH9_0790
    JKD6008:
    SAA6008_00780
    JKD6159:
    SAA6159_00722
    LGA251:
    SARLGA251_06980
    M013:
    M013TW_0752
    MRSA252:
    SAR0820
    MSHR1132:
    SAMSHR1132_07100
    MSSA476:
    SAS0730
    Mu3:
    SAHV_0762
    Mu50:
    SAV0765
    MW2:
    MW0727
    RF122:
    SAB0719
    ST398:
    SAPIG0842
    T0131:
    SAT0131_00837
    TCH60:
    HMPREF0772_12415
    TW20:
    SATW20_08400
    USA300_TCH1516:
    USA300HOU_0794
    VC40:
    SAVC_03470

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDNNEKEKSKSELLVVTGLSGAGKSLVIQCLEDMGYFCVDNLPPVLLPKFVELMEQGNPS
    N315            MDNNEKEKSKSELLVVTGLSGAGKSLVIQCLEDMGYFCVDNLPPVLLPKFVELMEQGNPS
    NCTC8325        MDNNEKEKSKSELLVVTGLSGAGKSLVIQCLEDMGYFCVDNLPPVLLPKFVELMEQGNPS
    Newman          MDNNEKEKSKSELLVVTGLSGAGKSLVIQCLEDMGYFCVDNLPPVLLPKFVELMEQGNPS
    USA300_FPR3757  MDNNEKEKSKSELLVVTGLSGAGKSLVIQCLEDMGYFCVDNLPPVLLPKFVELMEQGNPS
                    ************************************************************

    COL             LRKVAIAIDLRGKELFNSLVAVVDKVKSESDVIIDVMFLEASTEKLISRYKETRRAHPLM
    N315            LRKVAIAIDLRGKELFNSLVAVVDKVKSESDVIIDVMFLEASTEKLISRYKETRRAHPLM
    NCTC8325        LRKVAIAIDLRGKELFNSLVAVVDKVKSESDVIIDVMFLEASTEKLISRYKETRRAHPLM
    Newman          LRKVAIAIDLRGKELFNSLVAVVDKVKSESDVIIDVMFLEASTEKLISRYKETRRAHPLM
    USA300_FPR3757  LRKVAIAIDLRGKELFNSLVAVVDKVKSESDVIIDVMFLEASTEKLISRYKETRRAHPLM
                    ************************************************************

    COL             EQGKRSLINAINDEREHLSQIRSIANFVIDTTKLSPKELKERIRRYYEDEEFETFTINVT
    N315            EQGKRSLINAINDEREHLSQIRSIANFVIDTTKLSPKELKERIRRYYEDEEFETFTINVT
    NCTC8325        EQGKRSLINAINDEREHLSQIRSIANFVIDTTKLSPKELKERIRRYYEDEEFETFTINVT
    Newman          EQGKRSLINAINDEREHLSQIRSIANFVIDTTKLSPKELKERIRRYYEDEEFETFTINVT
    USA300_FPR3757  EQGKRSLINAINDEREHLSQIRSIANFVIDTTKLSPKELKERIRRYYEDEEFETFTINVT
                    ************************************************************

    COL             SFGFKHGIQMDADLVFDVRFLPNPYYVVDLRPLTGLDKDVYNYVMKWKETEIFFEKLTDL
    N315            SFGFKHGIQMDADLVFDVRFLPNPYYVVDLRPLTGLDKDVYNYVMKWKETEIFFEKLTDL
    NCTC8325        SFGFKHGIQMDADLVFDVRFLPNPYYVVDLRPLTGLDKDVYNYVMKWKETEIFFEKLTDL
    Newman          SFGFKHGIQMDADLVFDVRFLPNPYYVVDLRPLTGLDKDVYNYVMKWKETEIFFEKLTDL
    USA300_FPR3757  SFGFKHGIQMDADLVFDVRFLPNPYYVVDLRPLTGLDKDVYNYVMKWKETEIFFEKLTDL
                    ************************************************************

    COL             LDFMIPGYKKEGKSQLVIAIGCTGGQHRSVALAERLGNYLNEVFEYNVYVHHRDAHIESG
    N315            LDFMIPGYKKEGKSQLVIAIGCTGGQHRSVALAERLGNYLNEVFEYNVYVHHRDAHIESG
    NCTC8325        LDFMIPGYKKEGKSQLVIAIGCTGGQHRSVALAERLGNYLNEVFEYNVYVHHRDAHIESG
    Newman          LDFMIPGYKKEGKSQLVIAIGCTGGQHRSVALAERLGNYLNEVFEYNVYVHHRDAHIESG
    USA300_FPR3757  LDFMIPGYKKEGKSQLVIAIGCTGGQHRSVALAERLGNYLNEVFEYNVYVHHRDAHIESG
                    ************************************************************

    COL             EKK
    N315            EKK
    NCTC8325        EKK
    Newman          EKK
    USA300_FPR3757  EKK
                    ***