From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002692000
  • symbol?: whiA
  • description?: sporulation regulator WhiA

      descriptions from strain specific annotations:

    • sporulation regulator WhiA
    • putative sporulation transcription regulator whiA
    • cytoplasmic hypothetical protein
    • sporulation Regulator WhiA C terminal domain protein
  • strand?: +
  • coordinates?: 3185802..3186746
  • synteny block?: BlockID0019240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0745
    08BA02176:
    C248_0855
    11819-97:
    MS7_0817
    71193:
    ST398NM01_0844
    ECT-R 2:
    ECTR2_717
    ED133:
    SAOV_0805
    ED98:
    SAAV_0731
    HO 5096 0412:
    SAEMRSA15_06930
    JH1:
    SaurJH1_0808
    JH9:
    SaurJH9_0792
    JKD6008:
    SAA6008_00782 (whiA)
    JKD6159:
    SAA6159_00724 (whiA)
    LGA251:
    SARLGA251_07000
    M013:
    M013TW_0756
    MRSA252:
    SAR0822
    MSHR1132:
    SAMSHR1132_07120
    MSSA476:
    SAS0732
    Mu3:
    SAHV_0764
    Mu50:
    SAV0767
    MW2:
    MW0729
    RF122:
    SAB0721
    ST398:
    SAPIG0844
    T0131:
    SAT0131_00839
    TCH60:
    HMPREF0772_12413
    TW20:
    SATW20_08420
    USA300_TCH1516:
    USA300HOU_0796
    VC40:
    SAVC_03480

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSFASEMKNELTRIDVDEMNAKAELSALIRMNGALSLSNQQFVINVQTENATTARRIYSL
    N315            MSFASEMKNELTRIDVDEMNAKAELSALIRMNGALSLSNQQFVINVQTENATTARRIYSL
    NCTC8325        MSFASEMKNELTRIDVDEMNAKAELSALIRMNGALSLSNQQFVINVQTENATTARRIYSL
    Newman          MSFASEMKNELTRIDVDEMNAKAELSALIRMNGALSLSNQQFVINVQTENATTARRIYSL
    USA300_FPR3757  MSFASEMKNELTRIDVEEMNAKAELSALIRMNGALSLSNQQFVINVQTENATTARRIYSL
                    ****************:*******************************************

    COL             IKRVFNVEVEILVRKKMKLKKNNIYICRTKMKAKEILDELGILKDGIFTHEIDHSMIQDD
    N315            IKRVFNVEVEILVRKKMKLKKNNIYICRTKMKAKEILDELGILKDGIFTHEIDHSMIQDD
    NCTC8325        IKRVFNVEVEILVRKKMKLKKNNIYICRTKMKAKEILDELGILKDGIFTHEIDHSMIQDD
    Newman          IKRVFNVEVEILVRKKMKLKKNNIYICRTKMKAKEILDELGILKDGIFTHEIDHSMIQDD
    USA300_FPR3757  IKRVFNVEVEILVRKKMKLKKNNIYICRTKMKAKEILDELGILKDGIFTHEIDHSMIQDD
                    ************************************************************

    COL             EMRRSYLRGAFLAGGSVNNPETSSYHLEIFSQNESHAEGLTKLMNSYELNAKHLERKKGS
    N315            EMRRSYLRGAFLAGGSVNNPETSSYHLEIFSQNESHAEGLTKLMNSYELNAKHLERKKGS
    NCTC8325        EMRRSYLRGAFLAGGSVNNPETSSYHLEIFSQNESHAEGLTKLMNSYELNAKHLERKKGS
    Newman          EMRRSYLRGAFLAGGSVNNPETSSYHLEIFSQNESHAEGLTKLMNSYELNAKHLERKKGS
    USA300_FPR3757  EMRRSYLRGAFLAGGSVNNPETSSYHLEIFSQNESHAEGLTKLMNSYELNAKHLERKKGS
                    ************************************************************

    COL             ITYLKEAEKISDFLSLIGGYQALLKFEDVRIVRDMRNSVNRLVNCETANLNKTVSAAMKQ
    N315            ITYLKEAEKISDFLSLIGGYQALLKFEDVRIVRDMRNSVNRLVNCETANLNKTVSAAMKQ
    NCTC8325        ITYLKEAEKISDFLSLIGGYQALLKFEDVRIVRDMRNSVNRLVNCETANLNKTVSAAMKQ
    Newman          ITYLKEAEKISDFLSLIGGYQALLKFEDVRIVRDMRNSVNRLVNCETANLNKTVSAAMKQ
    USA300_FPR3757  ITYLKEAEKISDFLSLIGGYQALLKFEDVRIVRDMRNSVNRLVNCETANLNKTVSAAMKQ
                    ************************************************************

    COL             VESIKLIDKEIGIENLPDRLREIARIRVEHQEISLKELGEMVSTGPISKSGVNHRLRKLN
    N315            VESIKLIDKEIGIENLPDRLREIARIRVEHQEISLKELGEMVSTGPISKSGVNHRLRKLN
    NCTC8325        VESIKLIDKEIGIENLPDRLREIARIRVEHQEISLKELGEMVSTGPISKSGVNHRLRKLN
    Newman          VESIKLIDKEIGIENLPDRLREIARIRVEHQEISLKELGEMVSTGPISKSGVNHRLRKLN
    USA300_FPR3757  VESIKLIDKEIGIENLPDRLREIARIRVEHQEISLKELGEMVSTGPISKSGVNHRLRKLN
                    ************************************************************

    COL             DLADKIRNGEQIEL
    N315            DLADKIRNGEQIEL
    NCTC8325        DLADKIRNGEQIEL
    Newman          DLADKIRNGEQIEL
    USA300_FPR3757  DLADKIRNGEQIEL
                    **************