From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002713000
  • symbol?: est
  • description?: carboxylesterase

      descriptions from strain specific annotations:

    • carboxylesterase
    • carboxyesterase -like protein
    • carboxyesterase precursor homologue
    • carboxylesterase precursor
    • esterase/lipase-like protein
    • lipase/esterase
    • putative carboxylesterase
  • strand?: +
  • coordinates?: 3202306..3203046
  • synteny block?: BlockID0019450
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0845 (est)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0757
    08BA02176:
    C248_0870 (est)
    11819-97:
    MS7_0830 (est)
    71193:
    ST398NM01_0858
    ECT-R 2:
    ECTR2_730
    ED133:
    SAOV_0821
    ED98:
    SAAV_0745 (est)
    HO 5096 0412:
    SAEMRSA15_07060 (est)
    JH1:
    SaurJH1_0820
    JH9:
    SaurJH9_0804
    JKD6008:
    SAA6008_00794 (est)
    JKD6159:
    SAA6159_00736 (est)
    LGA251:
    SARLGA251_07130 (est)
    M013:
    M013TW_0770
    MRSA252:
    SAR0835 (est)
    MSHR1132:
    SAMSHR1132_07250
    MSSA476:
    SAS0745
    Mu3:
    SAHV_0776
    Mu50:
    SAV0779
    MW2:
    MW0741
    RF122:
    SAB0735
    ST398:
    SAPIG0858
    T0131:
    SAT0131_00852
    TCH60:
    HMPREF0772_12399 (est2)
    TW20:
    SATW20_08540 (est)
    USA300_TCH1516:
    USA300HOU_0809
    VC40:
    SAVC_03540

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPDEI
    N315            MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEI
    NCTC8325        MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPDEI
    Newman          MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPDEI
    USA300_FPR3757  MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPDEI
                    *********************************************************:**

    COL             LKSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
    N315            LKSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
    NCTC8325        LKSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
    Newman          LKSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
    USA300_FPR3757  LKSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
                    ************************************************************

    COL             KTEGAIYEGFLEYARNFKKYEGKDQETIDNEMDHFKPTETLKELSEALDTIKEQVDEVLD
    N315            KTEGAIYEGFLEYARNFKKYEGKNQETIDNEMDHFKPTETLKELSEALDTIKDQVDEVFD
    NCTC8325        KTEGAIYEGFLEYARNFKKYEGKDQETIDNEMDHFKPTETLKELSEALDTIKEQVDEVLD
    Newman          KTEGAIYEGFLEYARNFKKYEGKDQETIDNEMDHFKPTETLKELSEALDTIKEQVDEVLD
    USA300_FPR3757  KTEGAIYEGFLEYARNFKKYEGKDQETIDNEMDHFKPTETLKELSEALDTIKEQVDEVLD
                    ***********************:****************************:*****:*

    COL             PILVIQAENDNMIDPQSANYIYDHVDSDDKNIKWYSESGHVITIDKEKEQVFEDIYQFLE
    N315            PILVIQVENDNMIDPQSANYIYDHVDSDDKDIKWYSQSGHVITIDKEKEQVFEDIYQFLE
    NCTC8325        PILVIQAENDNMIDPQSANYIYDHVDSDDKNIKWYSESGHVITIDKEKEQVFEDIYQFLE
    Newman          PILVIQAENDNMIDPQSANYIYDHVDSDDKNIKWYSESGHVITIDKEKEQVFEDIYQFLE
    USA300_FPR3757  PILVIQAENDNMIDPQSANYIYDHVDSDDKNIKWYSESGHVITIDKEKEQVFEDIYQFLE
                    ******.***********************:*****:***********************

    COL             SLDWSE
    N315            SLDWSE
    NCTC8325        SLDWSE
    Newman          SLDWSE
    USA300_FPR3757  SLDWSE
                    ******