From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002778000
  • symbol?:
  • description?: N-acetyltransferase GCN5

      descriptions from strain specific annotations:

    • N-acetyltransferase GCN5
    • acetyltransferase (GNAT) family protein
    • acetyltransferase family protein
    • putative acetyltransferase
    • Acetyltransferase
  • strand?: +
  • coordinates?: 3247295..3247840
  • synteny block?: BlockID0019790
  • occurrence?: in 78% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0765
    08BA02176:
    11819-97:
    MS7_0838
    71193:
    ECT-R 2:
    ECTR2_738
    ED133:
    SAOV_0827
    ED98:
    SAAV_0756
    HO 5096 0412:
    JH1:
    SaurJH1_0827
    JH9:
    SaurJH9_0811
    JKD6008:
    SAA6008_00802
    JKD6159:
    SAA6159_00742
    LGA251:
    SARLGA251_07180
    M013:
    M013TW_0776
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS0751
    Mu3:
    SAHV_0806
    Mu50:
    SAV0810
    MW2:
    MW0763
    RF122:
    SAB0743
    ST398:
    T0131:
    SAT0131_00883
    TCH60:
    TW20:
    SATW20_08610
    USA300_TCH1516:
    USA300HOU_0818
    VC40:
    SAVC_03575

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQIRQIHQHDFAQVDQLIRTAFENSEHGYGNESELVDQIRLSDTYDNTLELVAVLQNEVV
    N315            MQIRQIHQHDFAQVDQLIRTAFENSEHGYGNESELVDQIRLSDTYDNNLEIVAVLQNEVV
    NCTC8325        MQIRQIHQHDFAQVDQLIRTAFENSEHGYGNESELVDQIRLSDTYDNTLELVAVLQNEVV
    Newman          MQIRQIHQHDFAQVDQLIRTAFENSEHGYGNESELVDQIRLSDTYDNTLELVAVLQNEVV
    USA300_FPR3757  MQIRQIHQHDFAQVDQLIRTAFENSEHGYGNESELVDQIRLSDTYDNTLELVAVLQNEVV
                    ***********************************************.**:*********

    COL             GHGLLSEVYLDNEAQREIGLVLAPVSVDIHHQNKGIGKRLIQALEREAILKGYNFISVLG
    N315            GHGLLSEVYLDNGAQREIGLVLAPVSVDIHHQNKGIGKRLIQALEREAILKGYNFISVLG
    NCTC8325        GHGLLSEVYLDNEAQREIGLVLAPVSVDIHHQNKGIGKRLIQALEREAILKGYNFISVLG
    Newman          GHGLLSEVYLDNEAQREIGLMLAPVSVDIHHQNKGIGKRLIQALEREAILKGYNFISVLG
    USA300_FPR3757  GHGLLSEVYLDNEAQREIGLVLAPVSVDIHHQNKGIGKRLIQALEREAILKGYNFISVLG
                    ************ *******:***************************************

    COL             WPTYYANLGYQRASMYDIYPPYDGIPDEAFLIKELKVNSLAGKTGTINYTSAFEKI
    N315            WPTYYANLGYQRASMYDIYPPYDGIPDEAFLIKELKVNSLAGKTGTINYTSAFEKI
    NCTC8325        WPTYYANLGYQRASMYDIYPPYDGIPDEAFLIKELKVNSLAGKTGTINYTSAFEKI
    Newman          WPTYYANLGYQRASMYDIYPPYDGIPDEAFLIKELKVNSLAGKTGTINYTSAFEKI
    USA300_FPR3757  WPTYYANLGYQRASMYDIYPPYDGIPDEAFLIKELKVNSLAGKTGTINYTSAFEKI
                    ********************************************************