From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002779000
  • symbol?: clfA
  • description?: fibrinogen-binding protein A, clumping factor

      descriptions from strain specific annotations:

    • fibrinogen-binding protein A, clumping factor
    • cell wall anchor domain-containing protein
    • Clumping factor ClfA, fibrinogen-binding protein
    • LPXTG-motif cell wall anchor domain-containing protein
    • clumping factor A
    • truncated clumping factor
  • strand?: +
  • coordinates?: 3248104..3260261
  • synteny block?: BlockID0019800
  • occurrence?: in 81% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0856 (clfA)
    N315:
    SA0742 (clfA)
    NCTC8325:
    Newman:
    NWMN_0756 (clfA)
    USA300_FPR3757:
    04-02981:
    SA2981_0766 (clfA)
    08BA02176:
    11819-97:
    MS7_0839 (clfA)
    71193:
    ECT-R 2:
    ECTR2_739
    ED133:
    SAOV_0828 (clfA)
    ED98:
    SAAV_0757 (clfA)
    HO 5096 0412:
    JH1:
    SaurJH1_0828
    JH9:
    SaurJH9_0812
    JKD6008:
    SAA6008_00803
    JKD6159:
    SAA6159_00743
    LGA251:
    SARLGA251_07190 (clfA)
    M013:
    M013TW_0777
    MRSA252:
    MSHR1132:
    SAMSHR1132_07360
    MSSA476:
    SAS0752
    Mu3:
    SAHV_0807 (fnb)
    Mu50:
    SAV0811 (fnb)
    MW2:
    MW0764 (clfA)
    RF122:
    SAB0744 (clfA)
    ST398:
    T0131:
    SAT0131_00886
    TCH60:
    TW20:
    SATW20_08620 (clfA)
    USA300_TCH1516:
    USA300HOU_0819 (clfA)
    VC40:
    SAVC_03580

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNMKKKEKHAIRKKSIGVASVLVGTLIGFGLLSSKEADASENSVTQSDSASNESKSNDSS
    N315            MNMKKKEKHAIRKKSIGVASVLVGTLIGFGLLSSKEADASENSVTQSDSASNESKSNDSS
    NCTC8325        MNMKKKEKHAIRKKSIGVASVLVGTLIGFGLLSSKEADASENSVTQSDSASNESKSNDSS
    Newman          MNMKKKEKHAIRKKSIGVASVLVGTLIGFGLLSSKEADASENSVTQSDSASNESKSNDSS
    USA300_FPR3757  MNMKKKEKHAIRKKSIGVASVLVGTLIGFGLLSSKEADASENSVTQSDSASNESKSNDSS
                    ************************************************************

    COL             SVSAAPKTDDTNVSDTKTSSNTNNGETSVAQNPAQQETTQSSSTNATTEETPVTGEATTT
    N315            SVSAAPKTDDTNVSDTKTSSNTNNGETSVAQNPAQQETTQSSSTNATTEETPVTGEATTT
    NCTC8325        SVSAAPKTDDTNVSDTKTSSNTNNGETSVAQNPAQQETTQSSSTNATTEETPVTGEATTT
    Newman          SVSAAPKTDDTNVSDTKTSSNTNNGETSVAQNPAQQETTQSSSTNATTEETPVTGEATTT
    USA300_FPR3757  SVSAAPKTDDTNVSDTKTSSNTNNGETSVAQNPAQQETTQSSSTNATTEETPVTGEATTT
                    ************************************************************

    COL             TTNQANTPATTQSSNTNAEELVNQTSNETTSNDTNTVSSVNSPQNSTNAENVSTTQDTST
    N315            TTNQANTPATTQSSNTNAEELVNQTSNETTSNDTNTVSSVNSPQNSTNAENVSTTQDTST
    NCTC8325        TTNQANTPATTQSSNTNAEELVNQTSNETTSNDTNTVSSVNSPQNSTNAENVSTTQDTST
    Newman          TTNQANTPATTQSSNTNAEELVNQTSNETTFNDTNTVSSVNSPQNSTNAENVSTTQDTST
    USA300_FPR3757  TTNQANTPATTQSSNTNAEELVNQTSNETTSNDTNTVSSVNSPQNSTNAENVSTTQDTST
                    ****************************** *****************************

    COL             EATPSNNESAPQSTDASNKDVVNQAVNTSAPRMRAFSLAAVAADAPAAGTDITNQLTNVT
    N315            EATPSNNESAPQNTDASNKDVVSQAVNPSTPRMRAFSLAAVAADAPAAGTDITNQLTDVK
    NCTC8325        EATPSNNESAPQSTDASNKDVVNQAVNTSAPRMRAFSLAAVAADAPVAGTDITNQLTNVT
    Newman          EATPSNNESAPQSTDASNKDVVNQAVNTSAPRMRAFSLAAVAADAPAAGTDITNQLTNVT
    USA300_FPR3757  EATPSNNESAPQSTDASNKDVVNQAVNTSAPRMRAFSLAAVAADAPAAGTDITNQLTNVT
                    ************.*********.****.*:****************.**********:*.

    COL             VGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAG
    N315            VTIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAG
    NCTC8325        VGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAG
    Newman          VGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAG
    USA300_FPR3757  VGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAG
                    * **********************************************************

    COL             DQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTT
    N315            DQVLANGVIDSDGNVIYTFTDYVDNKENVTANITMPAYIDPENVTKTGNVTLTTGIGTNT
    NCTC8325        DQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTT
    Newman          DQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTT
    USA300_FPR3757  DQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTT
                    ***********************:.*::*.*.:***********.*******:****:.*

    COL             ANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNT
    N315            ASKTVLIDYEKYGQFHNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVVLPALTGNLIPNT
    NCTC8325        ANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNT
    Newman          ANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNT
    USA300_FPR3757  ANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNT
                    *.****:******:*:*******************************: *.***** ***

    COL             DSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPD
    N315            KSNALIDAKNTDIKVYRVDNANDLSESYYVNPSDFEDVTNQVRISFPNANQYKVEFPTDD
    NCTC8325        DSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPD
    Newman          DSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPD
    USA300_FPR3757  DSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPD
                    .****** :**.****:**** ******:***.:******.*.*:***.******* * *

    COL             DQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGID
    N315            DQITTPYIVVVNGHIDPASTGDLALRSTFYGYDSNFIWRSMSWDNEVAFNNGSGSGDGID
    NCTC8325        DQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGID
    Newman          DQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGID
    USA300_FPR3757  DQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGID
                    ***************** *.********:***:**:************************

    COL             KPVVPEQPDEPGEIEPIPEDSDSDPGSDSGSDSNSDSGSDSGSDSTSDSGSDSASDSDSA
    N315            KPVVPEQPDEPGEIEPIPEDSDSDPGSDSGSDSNSDSGSDSGSDSTSDSGSDSASDSDSA
    NCTC8325        KPVVPEQPDEPGEIEPIPEDSDSDPGSDSGSDSNSDSGSDSGSDSTSDSGSDSASDSDSA
    Newman          KPVVPEQPDEPGEIEPIPEDSDSDPGSDSGSDSNSDSGSDSGSDSTSDSGSDSASDSDSA
    USA300_FPR3757  KPVVPEQPDEPGEIEPIPEDSDSDPGSDSGSDSNSDSGSDSGSDSTSDSGSDSASDSDSA
                    ************************************************************

    COL             SDSDSASDSDSASDSDSASDSD--------------------------------------
    N315            SDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSA
    NCTC8325        SDSDSASDSDSASDSDSASDSD--------------------------------------
    Newman          SDSDSASDSDSASDSDSASDSD--------------------------------------
    USA300_FPR3757  SDSDSASDSDSASDSDSASDSD--------------------------------------
                    **********************                                      

    COL             ------SDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
    N315            SDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
    NCTC8325        ------SDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
    Newman          ------SDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
    USA300_FPR3757  ------SDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
                          **.***************************************************

    COL             SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
    N315            SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
    NCTC8325        SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
    Newman          SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
    USA300_FPR3757  SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
                    ************************************************************

    COL             SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSD
    N315            SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDSESDSDSDSD
    NCTC8325        SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSD
    Newman          SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSD
    USA300_FPR3757  SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSD
                    ******************************* ********* *********:********

    COL             SDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSDSDSDSASDSDSGSDSDSSSDS---
    N315            SDSDSDSDSDSDSDSESDSDSDSDSDSESDSDSDSDSDSDSASDSDSGSDSDSSSDSDSD
    NCTC8325        SDSDSD------SDSDSESDSDSDSDSDSDSDSDSDSDSDSASDSDSGSDSDSSSDS---
    Newman          SDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSDSDSDSASDSDSGSDSDSSSDS---
    USA300_FPR3757  SDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSDSDSDSASDSDSGSDSDSSSDS---
                    ******      ***:*:*********:*****************************   

    COL             ---------DSESDSNSDSESGSNNNVVPPNSPKNGTNASNKNEAKDSKEPLPDTGSEDE
    N315            STSDTGSDNDSDSDSNSDSESGSNNNVVPPNSPKNGTNASNKNEAKDSKEPLPDTGSEDE
    NCTC8325        ---------DSESDSNSDSESVSNNNVVPPNSPKNGTNASNKNEAKDSKEPLPDTGSEDE
    Newman          ---------DSESDSNSDSESGSNNNVVPPNSPKNGTNASNKNEAKDSKEPLPDTGSEDE
    USA300_FPR3757  ---------DSESDSNSDSESGSNNNVVPPNSPKNGTNASNKNEAKDSKEPLPDTGSEDE
                             **:********* **************************************

    COL             ANTSLIWGLLASIGSLLLFRRKKENKDKK
    N315            ANTSLIWGLLASLGSLLLFRRKKENKDKK
    NCTC8325        ANTSLIWGLLASIGSLLLFRRKKENKDKK
    Newman          ANTSLIWGLLASIGSLLLFRRKKENKDKK
    USA300_FPR3757  ANTSLIWGLLASIGSLLLFRRKKENKDKK
                    ************:****************