From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002806000
  • symbol?:
  • description?: membrane protein
  • strand?: -
  • coordinates?: 3272636..3272824
  • synteny block?: BlockID0019970
  • occurrence?: in 81% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0775
    08BA02176:
    C248_0890
    11819-97:
    MS7_0848
    71193:
    ST398NM01_0876
    ECT-R 2:
    ECTR2_748
    ED133:
    SAOV_0837c
    ED98:
    SAAV_0766
    HO 5096 0412:
    SAEMRSA15_07230
    JH1:
    SaurJH1_0837
    JH9:
    SaurJH9_0821
    JKD6008:
    SAA6008_00812
    JKD6159:
    SAA6159_00752
    LGA251:
    M013:
    M013TW_0787
    MRSA252:
    SAR0852
    MSHR1132:
    SAMSHR1132_07450
    MSSA476:
    SAS0761
    Mu3:
    SAHV_0816
    Mu50:
    SAV0820
    MW2:
    MW0774
    RF122:
    SAB0753c
    ST398:
    SAPIG0876
    T0131:
    TCH60:
    HMPREF0772_12382
    TW20:
    USA300_TCH1516:
    VC40:
    SAVC_03630

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFG
    NCTC8325        MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFG
    Newman          MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTIILYIFGFAILIYTFIFG
                    *****************************.************:*****************

    N315            VL
    NCTC8325        VL
    Newman          VL
                    **