From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002821000
  • symbol?: gcvH
  • description?: glycine cleavage system protein H

      descriptions from strain specific annotations:

    • glycine cleavage system protein H
    • Glycine cleavage system H protein
  • strand?: +
  • coordinates?: 3279537..3279917
  • synteny block?: BlockID0020120
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0877 (gcvH)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0788
    08BA02176:
    C248_0901 (gcvH)
    11819-97:
    MS7_0859 (gcvH)
    71193:
    ST398NM01_0887
    ECT-R 2:
    ECTR2_759 (gcvH)
    ED133:
    SAOV_0849
    ED98:
    HO 5096 0412:
    SAEMRSA15_07350 (gcvH)
    JH1:
    SaurJH1_0849
    JH9:
    SaurJH9_0832
    JKD6008:
    SAA6008_00823 (gcvH)
    JKD6159:
    SAA6159_00764 (gcvH)
    LGA251:
    SARLGA251_07390 (gcvH)
    M013:
    M013TW_0798
    MRSA252:
    SAR0864 (gcvH)
    MSHR1132:
    SAMSHR1132_07570
    MSSA476:
    SAS0773
    Mu3:
    SAHV_0829
    Mu50:
    SAV0833
    MW2:
    MW0786
    RF122:
    SAB0764 (gcvH)
    ST398:
    SAPIG0887 (gcvH)
    T0131:
    SAT0131_00907 (hld)
    TCH60:
    HMPREF0772_12370 (gcvH)
    TW20:
    SATW20_08820 (gcvH)
    USA300_TCH1516:
    USA300HOU_0840 (gcvH)
    VC40:
    SAVC_03690

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAVPNELKYSKEHEWVKVEGNVAIIGITEYAQSELGDIVFVELPETDDEINEGDTFGSVE
    N315            MAVPNELKYSKEHEWVKVEGNVATIGITEYAQSELGDIVFVELPETDDEINEGDTFGSVE
    NCTC8325        MAVPNELKYSKEHEWVKVEGNVAIIGITEYAQSELGDIVFVELPETDDEINEGDTFGSVE
    Newman          MAVPNELKYSKEHEWVKVEGNVAIIGITEYAQSELGDIVFVELPETDDEINEGDTFGSVE
    USA300_FPR3757  MAVPNELKYSKEHEWVKVEGNVAIIGITEYAQSELGDIVFVELPETDDEINEGDTFGSVE
                    *********************** ************************************

    COL             SVKTVSELYAPISGKVVEVNEELEDSPEFVNESPYEKAWMVKVEISDESQIEALLTAEKY
    N315            SVKTVSELYAPISGKVVEVNEELEDSPEFVNESPYEKAWMVKVEISDESQLEALLTAEKY
    NCTC8325        SVKTVSELYAPISGKVVEVNEELEDSPEFVNESPYEKAWMVKVEISDESQIEALLTAEKY
    Newman          SVKTVSELYAPISGKVVEVNEELEDSPEFVNESPYEKAWMVKVEISDESQIEALLTAEKY
    USA300_FPR3757  SVKTVSELYAPISGKVVEVNEELEDSPEFVNESPYEKAWMVKVEISDESQIEALLTAEKY
                    **************************************************:*********

    COL             SEMIGE
    N315            SEMIGE
    NCTC8325        SEMIGE
    Newman          SEMIGE
    USA300_FPR3757  SEMIGE
                    ******